GET /api/protein/UniProt/A0A7L8AFM1/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A7L8AFM1",
        "id": "A0A7L8AFM1_9FLAO",
        "source_organism": {
            "taxId": "1888915",
            "scientificName": "Polaribacter haliotis",
            "fullName": "Polaribacter haliotis"
        },
        "name": "ATP-dependent 6-phosphofructokinase",
        "description": [
            "Catalyzes the phosphorylation of D-fructose 6-phosphate to fructose 1,6-bisphosphate by ATP, the first committing step of glycolysis"
        ],
        "length": 327,
        "sequence": "MKKIKKIAVMTSGGDAPGMNAAIRSVVRACAYYRVSCVGIYRGYEGLIEGDFIELTARSVNNIINKGGTILKSARSKEFRTKEGRAKAYEHLKENNIEAMVVIGGDGSFTGAVIFNEEYKFPVIGIPGTIDNDIFGTTHTLGYDTALNTAVEAIDKIRDTASSHNRLFFVEVMGRDAGFIALNAGVGAGAEEILIPEEDLGLERMLESLKKSRRTGKSSSIVVVAEGDKSGKNVYELAQYVEENLPEYDVRVSVLGHMQRGGSPSCFDRVLASRLGVKSVELLLDGQTNLMVGLKNNEVISTSIAEAIKGGHSINQELLRVSDIMTT",
        "proteome": "UP000516764",
        "gene": "pfkA",
        "go_terms": [
            {
                "identifier": "GO:0003872",
                "name": "6-phosphofructokinase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006096",
                "name": "glycolytic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0005524",
                "name": "ATP binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0008443",
                "name": "phosphofructokinase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006002",
                "name": "fructose 6-phosphate metabolic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "c47239981a029609f58ab64a8107d57cef15dd9e",
        "counters": {
            "domain_architectures": 37322,
            "entries": 17,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "pfam": 1,
                "cathgene3d": 2,
                "panther": 1,
                "pirsf": 1,
                "hamap": 1,
                "ncbifam": 2,
                "prints": 1,
                "prosite": 1,
                "interpro": 6
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 37322
        }
    }
}