GET /api/protein/UniProt/A0A7L5TW91/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A7L5TW91",
"id": "A0A7L5TW91_ASPSC",
"source_organism": {
"taxId": "8607",
"scientificName": "Aspidelaps scutatus",
"fullName": "Aspidelaps scutatus (Shield-nose snake)"
},
"name": "NADH-ubiquinone oxidoreductase chain 4",
"description": [
"Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone"
],
"length": 219,
"sequence": "LKMGGYGIIRMTQTLPTLKTDVFLPFIILSLWGAILTSLTCLQQTDLKSLIAYSSISHMGLVIAAMSIQTQWSLSGAMAMMIAHGFTSSALFCLANTTYERTQTRILILTRGFHNILPMTTTWWLLTNLTNIATPPSMNFTSELLIASSLFNWCPTSIILFGLLMLITATYSLHMFLSTQMNFTTLNTPIQPTHSREHLLLTLHILPLILISLKPELII",
"proteome": null,
"gene": "ND4",
"go_terms": [
{
"identifier": "GO:0008137",
"name": "NADH dehydrogenase (ubiquinone) activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0042773",
"name": "ATP synthesis coupled electron transport",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": true,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "30faf52ccf77815d26cefd5a8a86610417a47c43",
"counters": {
"domain_architectures": 148734,
"entries": 4,
"isoforms": 0,
"proteomes": 0,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"pfam": 1,
"panther": 1,
"interpro": 2
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 148734
}
}
}