HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A7L5BEE2",
"id": "A0A7L5BEE2_9HYPH",
"source_organism": {
"taxId": "2267833",
"scientificName": "Rhizobium oryzihabitans",
"fullName": "Rhizobium oryzihabitans"
},
"name": "Methionine--tRNA ligase",
"description": [
"Is required not only for elongation of protein synthesis but also for the initiation of all mRNA translation through initiator tRNA(fMet) aminoacylation"
],
"length": 516,
"sequence": "MTDKTPFYITTAISYPNGKPHIGHAYELIATDAMARFQRLDGMDVFFLTGTDEHGQKMQQTARAEGISPEELAQRNSDQFREMGKLLNASNDDFIRTTEERHHETSRNIWNLMADSGDIYKDSYAGWYSVRDEAYYGEDETEVRADGVRYGPQGTPVEWVEEESYFFKLSEYQDKLLKLYEENPEFIGPAERRNEIISFVKSGLKDLSISRTTFDWGIKVPNDPKHVMYVWVDALTNYITATGYIEDKNGPRAKYWPADVHIIGKDIIRFHAVYWPAFLMSAKLPLPKRVYAHGFLLNKGEKMSKSLGNVVDPVNLVNHFGLDQVRYFFMREVSFGQDGSYSEEGIATRINADLANGIGNLASRSLSMIVKNCDGQIPTPGELTDEDKAMLASADGLLVVCRDEMGKQLIHRALAAIIAVVSETDRYFASQEPWALKKTDPERMGTVLYVTAEVVRQIGILLQPFMPESCEKLLDLVAAPADKRDFAALGEAGRLVPGTPLEAPKPVFPRYVAPEA",
"proteome": "UP000464865",
"gene": "metG",
"go_terms": [
{
"identifier": "GO:0004825",
"name": "methionine-tRNA ligase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006431",
"name": "methionyl-tRNA aminoacylation",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0000166",
"name": "nucleotide binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0004812",
"name": "aminoacyl-tRNA ligase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0005524",
"name": "ATP binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006418",
"name": "tRNA aminoacylation for protein translation",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "1f925c6beb58222fd45aaf230f24f80ec82b4a2f",
"counters": {
"domain_architectures": 11154,
"entries": 23,
"isoforms": 0,
"proteomes": 1,
"sets": 4,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 2,
"cdd": 2,
"cathgene3d": 3,
"pfam": 2,
"hamap": 1,
"panther": 1,
"ncbifam": 2,
"prosite": 1,
"prints": 1,
"interpro": 8
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 11154
}
}
}