GET /api/protein/UniProt/A0A7L4KQY0/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A7L4KQY0",
        "id": "A0A7L4KQY0_9CORV",
        "source_organism": {
            "taxId": "1347786",
            "scientificName": "Callaeas wilsoni",
            "fullName": "Callaeas wilsoni (North Island kokako)"
        },
        "name": "Receptor activity-modifying protein 1",
        "description": [
            "Accessory protein that interacts with and modulates the function of G-protein coupled receptors including calcitonin gene-related peptide type 1 receptor (CALCRL) and calcitonin receptor (CALCR). Required for the transport of CALCRL to the plasma membrane. Together with CALCRL, form the receptor complex for the calcitonin gene-related peptides CGRP1/CALCA and CGRP2/CALCB. Together with CALCR, form the AMYR1 receptor complex for amylin/IAPP and CGRP1/CALCA"
        ],
        "length": 132,
        "sequence": "AAQHFIAATACQEADYGWMIRHYCLKQFQLSMEGIGQRLWCDWDETVGTYGELTNCTALIAERLDCYWPNRLVDEFFVAVHKQYFRNCSPSGRALHDPPNGVLCPFIVLPVLVTLLMTALVVWRSKRSEGIV",
        "proteome": "UP000576729",
        "gene": "Ramp1",
        "go_terms": [
            {
                "identifier": "GO:0015026",
                "name": "coreceptor activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006886",
                "name": "intracellular protein transport",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0008277",
                "name": "regulation of G protein-coupled receptor signaling pathway",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0016020",
                "name": "membrane",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": true,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "cd3ac1cd2b928e5623e450784ade126e95738889",
        "counters": {
            "domain_architectures": 3120,
            "entries": 5,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "panther": 1,
                "pfam": 1,
                "interpro": 2
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 3120
        }
    }
}