HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A7L4KQY0",
"id": "A0A7L4KQY0_9CORV",
"source_organism": {
"taxId": "1347786",
"scientificName": "Callaeas wilsoni",
"fullName": "Callaeas wilsoni (North Island kokako)"
},
"name": "Receptor activity-modifying protein 1",
"description": [
"Accessory protein that interacts with and modulates the function of G-protein coupled receptors including calcitonin gene-related peptide type 1 receptor (CALCRL) and calcitonin receptor (CALCR). Required for the transport of CALCRL to the plasma membrane. Together with CALCRL, form the receptor complex for the calcitonin gene-related peptides CGRP1/CALCA and CGRP2/CALCB. Together with CALCR, form the AMYR1 receptor complex for amylin/IAPP and CGRP1/CALCA"
],
"length": 132,
"sequence": "AAQHFIAATACQEADYGWMIRHYCLKQFQLSMEGIGQRLWCDWDETVGTYGELTNCTALIAERLDCYWPNRLVDEFFVAVHKQYFRNCSPSGRALHDPPNGVLCPFIVLPVLVTLLMTALVVWRSKRSEGIV",
"proteome": "UP000576729",
"gene": "Ramp1",
"go_terms": [
{
"identifier": "GO:0015026",
"name": "coreceptor activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006886",
"name": "intracellular protein transport",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0008277",
"name": "regulation of G protein-coupled receptor signaling pathway",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0016020",
"name": "membrane",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": true,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "cd3ac1cd2b928e5623e450784ade126e95738889",
"counters": {
"domain_architectures": 3120,
"entries": 5,
"isoforms": 0,
"proteomes": 1,
"sets": 0,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"panther": 1,
"pfam": 1,
"interpro": 2
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 3120
}
}
}