GET /api/protein/UniProt/A0A7L3WNA4/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A7L3WNA4",
"id": "A0A7L3WNA4_9GRUI",
"source_organism": {
"taxId": "2478892",
"scientificName": "Atlantisia rogersi",
"fullName": "Atlantisia rogersi (Inaccessible Island rail)"
},
"name": "Ectonucleoside triphosphate diphosphohydrolase 1",
"description": [
"Catalyzes the hydrolysis of both di- and triphosphate nucleotides (NDPs and NTPs) and hydrolyze NTPs to nucleotide monophosphates (NMPs) in two distinct successive phosphate-releasing steps, with NDPs as intermediates and participates in the regulation of extracellular levels of nucleotides. By hydrolyzing proinflammatory ATP and platelet-activating ADP to AMP, it blocks platelet aggregation and supports blood flow"
],
"length": 262,
"sequence": "KILFILGFFSTLAVIALIAVAVTQNKPLPKNVKYGIVLDAGSSHTNLYVYEWPAEKENDTGVVQQVEVCKVEGPGISGYSHDTEKAGPSLAQCLRQAEKVIPSKQHQETPVYLGATAGMRLLSLENKSAADNVLSSVEKTLLSAPFSFQGARIISGQEEGAYGWITINYLLGNFKQVLYQWQSGWKKFLHSLKSISETSGALDLGGASTQITFVPNELTSGSPENLLYFRLYGKNYQVYTHSFLCYGKDQALQQKLARDLQA",
"proteome": "UP000518911",
"gene": "Entpd1_0",
"go_terms": [
{
"identifier": "GO:0016787",
"name": "hydrolase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": true,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "a977d00bde8672c76ffaaa6fe0b46fcc438a712c",
"counters": {
"domain_architectures": 20392,
"entries": 6,
"isoforms": 0,
"proteomes": 1,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 2,
"panther": 1,
"pfam": 1,
"prosite": 1,
"interpro": 1
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 20392
}
}
}