GET /api/protein/UniProt/A0A7L3WNA4/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A7L3WNA4",
        "id": "A0A7L3WNA4_9GRUI",
        "source_organism": {
            "taxId": "2478892",
            "scientificName": "Atlantisia rogersi",
            "fullName": "Atlantisia rogersi (Inaccessible Island rail)"
        },
        "name": "Ectonucleoside triphosphate diphosphohydrolase 1",
        "description": [
            "Catalyzes the hydrolysis of both di- and triphosphate nucleotides (NDPs and NTPs) and hydrolyze NTPs to nucleotide monophosphates (NMPs) in two distinct successive phosphate-releasing steps, with NDPs as intermediates and participates in the regulation of extracellular levels of nucleotides. By hydrolyzing proinflammatory ATP and platelet-activating ADP to AMP, it blocks platelet aggregation and supports blood flow"
        ],
        "length": 262,
        "sequence": "KILFILGFFSTLAVIALIAVAVTQNKPLPKNVKYGIVLDAGSSHTNLYVYEWPAEKENDTGVVQQVEVCKVEGPGISGYSHDTEKAGPSLAQCLRQAEKVIPSKQHQETPVYLGATAGMRLLSLENKSAADNVLSSVEKTLLSAPFSFQGARIISGQEEGAYGWITINYLLGNFKQVLYQWQSGWKKFLHSLKSISETSGALDLGGASTQITFVPNELTSGSPENLLYFRLYGKNYQVYTHSFLCYGKDQALQQKLARDLQA",
        "proteome": "UP000518911",
        "gene": "Entpd1_0",
        "go_terms": [
            {
                "identifier": "GO:0016787",
                "name": "hydrolase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": true,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "a977d00bde8672c76ffaaa6fe0b46fcc438a712c",
        "counters": {
            "domain_architectures": 20392,
            "entries": 6,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 2,
                "panther": 1,
                "pfam": 1,
                "prosite": 1,
                "interpro": 1
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 20392
        }
    }
}