General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A7L3VWZ9",
        "id": "A0A7L3VWZ9_MOLAT",
        "source_organism": {
            "taxId": "84834",
            "scientificName": "Molothrus ater",
            "fullName": "Molothrus ater (Brown-headed cowbird)"
        },
        "name": "Adrenocorticotropic hormone receptor",
        "description": [
            "Hormone receptor primarily expressed in adrenal cortex that plays a key role in regulating adrenocortical function. Upon corticotropin (ACTH) binding, facilitates the release of adrenal glucocorticoids, including cortisol and corticosterone. In addition, MC2R is required for fetal and neonatal adrenal gland development. Mechanistically, activates adenylate cyclase (cAMP), the MAPK cascade as well as the cAMP-dependent protein kinase A pathway leading to steroidogenic factor 1/NR5A1-mediated transcriptional activation"
        ],
        "length": 292,
        "sequence": "ENMSDFSLNISDCTQVVVPEEVFFTVAAAGILENLLILIAVVRNKNLHLPMYFFICSLAISDMLGSLYKTLENIFIILCKMGYLTRHGDFEKKLDDAMDSMFILSLLGSIFSLLAIAADRYITIFYALRYHNIMTLRRALVILAIIWAFCAGSSIAIALFSYEAATVIPFTIFFPLMMFFILCLYVHMFLLARSHAKKIASLPSSTVHHRTNMKGAITLTIFLGVFLCCWAPFVLHILLARFCPHNPYCACYMSIFHVNGTLIMCNAIINPMIFAFRSPELRSTFRKMFCPR",
        "proteome": "UP000553862",
        "gene": "Mc2r",
        "go_terms": [
            {
                "identifier": "GO:0004930",
                "name": "G protein-coupled receptor activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0007186",
                "name": "G protein-coupled receptor signaling pathway",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0016020",
                "name": "membrane",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            },
            {
                "identifier": "GO:0004978",
                "name": "corticotropin receptor activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0004977",
                "name": "melanocortin receptor activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": true,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "5040ebb238de8327affa8e634607f69b286b63d6",
        "counters": {
            "domain_architectures": 11561,
            "entries": 15,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "cdd": 1,
                "ssf": 1,
                "smart": 1,
                "pfam": 1,
                "profile": 1,
                "panther": 1,
                "prosite": 1,
                "prints": 3,
                "interpro": 4
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 11561
        }
    }
}