GET /api/protein/UniProt/A0A7L3SX90/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A7L3SX90",
        "id": "A0A7L3SX90_RISTR",
        "source_organism": {
            "taxId": "75485",
            "scientificName": "Rissa tridactyla",
            "fullName": "Rissa tridactyla (Black-legged kittiwake)"
        },
        "name": "Enoyl-CoA delta isomerase 1, mitochondrial",
        "description": [
            "Key enzyme of fatty acid beta-oxidation. Able to isomerize both 3-cis (3Z) and 3-trans (3E) double bonds into the 2-trans (2E) form in a range of enoyl-CoA species, with a preference for (3Z)-enoyl-CoAs over (3E)-enoyl-CoAs. The catalytic efficiency of this enzyme is not affected by the fatty acyl chain length"
        ],
        "length": 294,
        "sequence": "SVPPGVLPLCRQLLAWGRAPRQPPGLLLAQCRAFSNNKIMVELDESSGVATMKFKSPPVNSLSLDFLTEFCISLEKLENNRACRGVIITSAVPKIFSSGLDITEMCGKSTEHYAEFWRAVQEMWLRLYGSNMVTVAAVNGSSPAGGCLIALSCDYRIMVENPKFSIGLNEAQLGIVAPFWFKDTFVNIVGHRVAERSLQLGSLHPAPEAHRFGLVDELVPEEKLQEKTGAVMAQWLALPDHARQLTKSMMRKAVLDRLVAHREEDIQNFISFISKESIQKSLRMYMEMLKKKKG",
        "proteome": "UP000540089",
        "gene": "Eci1",
        "go_terms": [
            {
                "identifier": "GO:0003824",
                "name": "catalytic activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": true,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "85fd9293934e46900259fe1d97d9dca260c2baea",
        "counters": {
            "domain_architectures": 204728,
            "entries": 10,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 2,
                "ssf": 1,
                "cdd": 1,
                "pfam": 1,
                "panther": 1,
                "prosite": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 204728
        }
    }
}