GET /api/protein/UniProt/A0A7L3SX90/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A7L3SX90",
"id": "A0A7L3SX90_RISTR",
"source_organism": {
"taxId": "75485",
"scientificName": "Rissa tridactyla",
"fullName": "Rissa tridactyla (Black-legged kittiwake)"
},
"name": "Enoyl-CoA delta isomerase 1, mitochondrial",
"description": [
"Key enzyme of fatty acid beta-oxidation. Able to isomerize both 3-cis (3Z) and 3-trans (3E) double bonds into the 2-trans (2E) form in a range of enoyl-CoA species, with a preference for (3Z)-enoyl-CoAs over (3E)-enoyl-CoAs. The catalytic efficiency of this enzyme is not affected by the fatty acyl chain length"
],
"length": 294,
"sequence": "SVPPGVLPLCRQLLAWGRAPRQPPGLLLAQCRAFSNNKIMVELDESSGVATMKFKSPPVNSLSLDFLTEFCISLEKLENNRACRGVIITSAVPKIFSSGLDITEMCGKSTEHYAEFWRAVQEMWLRLYGSNMVTVAAVNGSSPAGGCLIALSCDYRIMVENPKFSIGLNEAQLGIVAPFWFKDTFVNIVGHRVAERSLQLGSLHPAPEAHRFGLVDELVPEEKLQEKTGAVMAQWLALPDHARQLTKSMMRKAVLDRLVAHREEDIQNFISFISKESIQKSLRMYMEMLKKKKG",
"proteome": "UP000540089",
"gene": "Eci1",
"go_terms": [
{
"identifier": "GO:0003824",
"name": "catalytic activity",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": true,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "85fd9293934e46900259fe1d97d9dca260c2baea",
"counters": {
"domain_architectures": 204728,
"entries": 10,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 2,
"ssf": 1,
"cdd": 1,
"pfam": 1,
"panther": 1,
"prosite": 1,
"interpro": 3
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 204728
}
}
}