HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A7L1GEW2",
"id": "A0A7L1GEW2_9PICI",
"source_organism": {
"taxId": "545262",
"scientificName": "Indicator maculatus",
"fullName": "Indicator maculatus (spotted honeyguide)"
},
"name": "Peroxisomal acyl-coenzyme A oxidase 1",
"description": null,
"length": 625,
"sequence": "EALVLNDPDFQHEDMNFLSRSERYEQALRKSALMVMKLREHGVADPDEIYWFKSFVHRGRPEPLDLHLGMFLPTLLAQATPEQQDRFFMPAWNLDIIGTYAQTEMGHGTHLRGLETTATYDPATQEFILNSPTVSSIKWWPGGLGKTSNHAIVLAQLYTQGQCRGLHAFIVPIRQIGTHKPLPGITVGDIGPKFGFDEIDNGYLKMDNYRIPRENMLMKYAQVEPDGTYVKPVSDKLTYGTMVFIRSLIVGDAARGLSKACTIAIRYSAVRHQSELKPGEPEPQILDYQTQQYKLFPLLATAYAFHIVGAYIKTTYHRISGDISSGNLSELPELHALTAGLKAFTSWVASAGVEECRMACGGHGYSRCSGIPDIYINLTPCCTYEGENTVMMLQTARFLVKSYNQVTSGQPVTGIVSYLNDLSRQRIQPQHVAARMVTVRINDPASLVEAYKARAACLVETAAKNLQAELNHRKSKEEAWNKTSVDLVRASEAHCHYVVVKLFAAKLSEVSDAAVRAVLTELCLLYALYGISKNTGDFLQAGILTDAQVTQVNQHVKELLAIIRPNAVALVDSFDFHDLLLGSVLGRYDGNVYENMFDWAKKSPLNKTEVHQSFYKHLKPMQSKL",
"proteome": "UP000557230",
"gene": "Acox1",
"go_terms": [
{
"identifier": "GO:0016627",
"name": "oxidoreductase activity, acting on the CH-CH group of donors",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0050660",
"name": "flavin adenine dinucleotide binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0003997",
"name": "acyl-CoA oxidase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0005504",
"name": "fatty acid binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0071949",
"name": "FAD binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0033540",
"name": "fatty acid beta-oxidation using acyl-CoA oxidase",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0006631",
"name": "fatty acid metabolic process",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0005777",
"name": "peroxisome",
"category": {
"code": "C",
"name": "cellular_component"
}
},
{
"identifier": "GO:0006635",
"name": "fatty acid beta-oxidation",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": true,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "c5f50b1239c8dc2a66db299fa7f7c37611ecdffb",
"counters": {
"domain_architectures": 4194,
"entries": 22,
"isoforms": 0,
"proteomes": 1,
"sets": 3,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 3,
"pfam": 4,
"cdd": 1,
"ssf": 2,
"panther": 1,
"pirsf": 1,
"interpro": 10
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 4194
}
}
}