GET /api/protein/UniProt/A0A7L1GEW2/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A7L1GEW2",
        "id": "A0A7L1GEW2_9PICI",
        "source_organism": {
            "taxId": "545262",
            "scientificName": "Indicator maculatus",
            "fullName": "Indicator maculatus (spotted honeyguide)"
        },
        "name": "Peroxisomal acyl-coenzyme A oxidase 1",
        "description": null,
        "length": 625,
        "sequence": "EALVLNDPDFQHEDMNFLSRSERYEQALRKSALMVMKLREHGVADPDEIYWFKSFVHRGRPEPLDLHLGMFLPTLLAQATPEQQDRFFMPAWNLDIIGTYAQTEMGHGTHLRGLETTATYDPATQEFILNSPTVSSIKWWPGGLGKTSNHAIVLAQLYTQGQCRGLHAFIVPIRQIGTHKPLPGITVGDIGPKFGFDEIDNGYLKMDNYRIPRENMLMKYAQVEPDGTYVKPVSDKLTYGTMVFIRSLIVGDAARGLSKACTIAIRYSAVRHQSELKPGEPEPQILDYQTQQYKLFPLLATAYAFHIVGAYIKTTYHRISGDISSGNLSELPELHALTAGLKAFTSWVASAGVEECRMACGGHGYSRCSGIPDIYINLTPCCTYEGENTVMMLQTARFLVKSYNQVTSGQPVTGIVSYLNDLSRQRIQPQHVAARMVTVRINDPASLVEAYKARAACLVETAAKNLQAELNHRKSKEEAWNKTSVDLVRASEAHCHYVVVKLFAAKLSEVSDAAVRAVLTELCLLYALYGISKNTGDFLQAGILTDAQVTQVNQHVKELLAIIRPNAVALVDSFDFHDLLLGSVLGRYDGNVYENMFDWAKKSPLNKTEVHQSFYKHLKPMQSKL",
        "proteome": "UP000557230",
        "gene": "Acox1",
        "go_terms": [
            {
                "identifier": "GO:0016627",
                "name": "oxidoreductase activity, acting on the CH-CH group of donors",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0050660",
                "name": "flavin adenine dinucleotide binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0003997",
                "name": "acyl-CoA oxidase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0005504",
                "name": "fatty acid binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0071949",
                "name": "FAD binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0033540",
                "name": "fatty acid beta-oxidation using acyl-CoA oxidase",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0006631",
                "name": "fatty acid metabolic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0005777",
                "name": "peroxisome",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            },
            {
                "identifier": "GO:0006635",
                "name": "fatty acid beta-oxidation",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": true,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "c5f50b1239c8dc2a66db299fa7f7c37611ecdffb",
        "counters": {
            "domain_architectures": 4194,
            "entries": 22,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 3,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 3,
                "pfam": 4,
                "cdd": 1,
                "ssf": 2,
                "panther": 1,
                "pirsf": 1,
                "interpro": 10
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 4194
        }
    }
}