General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A7L0FJY5",
        "id": "A0A7L0FJY5_CORCN",
        "source_organism": {
            "taxId": "103956",
            "scientificName": "Corythaixoides concolor",
            "fullName": "Corythaixoides concolor (Grey go-away-bird)"
        },
        "name": "Platelet-derived growth factor (PDGF) family profile domain-containing protein",
        "description": [
            "Growth factor active in angiogenesis, vasculogenesis and endothelial cell growth. Induces endothelial cell proliferation, promotes cell migration, inhibits apoptosis and induces permeabilization of blood vessels. Binds to the FLT1/VEGFR1 and KDR/VEGFR2 receptors, heparan sulfate and heparin"
        ],
        "length": 173,
        "sequence": "LLVIKFLEVYERSFCRTIETLVDIFQEYPDEVEYIFKPSCVPLMRCAGCCGDEGLECVPVDVYNVTMEIMRIKPHQSQHIAHMSFLQHSKCDCRPKKDVKNKQEKKSKRGKGKGQKRKRKKGRYKPLSFHCEPCSERRKHLFVQDPQTCKCSCKFTDSRCKSRQLELNERTCR",
        "proteome": "UP000526942",
        "gene": "Vegfa",
        "go_terms": [
            {
                "identifier": "GO:0008083",
                "name": "growth factor activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0016020",
                "name": "membrane",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            },
            {
                "identifier": "GO:0008201",
                "name": "heparin binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": true,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "82f9ea6e740d23cb5b8e79210b0b91e134330f7d",
        "counters": {
            "domain_architectures": 435,
            "entries": 17,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "profile": 1,
                "cathgene3d": 2,
                "ssf": 2,
                "smart": 1,
                "cdd": 1,
                "pfam": 2,
                "panther": 1,
                "prosite": 1,
                "interpro": 6
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 435
        }
    }
}