GET /api/protein/UniProt/A0A7L0BH32/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A7L0BH32",
"id": "A0A7L0BH32_9AVES",
"source_organism": {
"taxId": "252798",
"scientificName": "Spizaetus tyrannus",
"fullName": "Spizaetus tyrannus (black hawk-eagle)"
},
"name": "Sterol carrier protein 2",
"description": [
"Mediates the transfer of all common phospholipids, cholesterol and gangliosides from the endoplasmic reticulum to the plasma membrane. May play a role in regulating steroidogenesis. Stimulates the microsomal conversion of 7-dehydrocholesterol to cholesterol. Also binds fatty acids and fatty acyl Coenzyme A (CoA) such as phytanoyl-CoA. Involved in the regulation phospholipid synthesis in endoplasmic reticulum enhancing the incorporation of exogenous fatty acid into glycerides. Seems to stimulate the rate-limiting step in phosphatidic acid formation mediated by GPAT3. Isoforms SCP2 and SCPx cooperate in peroxisomal oxidation of certain naturally occurring tetramethyl-branched fatty acyl-CoAs",
"Plays a crucial role in the peroxisomal oxidation of branched-chain fatty acids. Catalyzes the last step of the peroxisomal beta-oxidation of branched chain fatty acids and the side chain of the bile acid intermediates di- and trihydroxycoprostanic acids (DHCA and THCA). Also active with medium and long straight chain 3-oxoacyl-CoAs. Stimulates the microsomal conversion of 7-dehydrocholesterol to cholesterol and transfers phosphatidylcholine and 7-dehydrocholesterol between membrances, in vitro. Isoforms SCP2 and SCPx cooperate in peroxisomal oxidation of certain naturally occurring tetramethyl-branched fatty acyl-CoAs"
],
"length": 521,
"sequence": "QFTKPDEKSVDYPDMAKEAGQKALADAGILYSEVEQACVGYVYGDSTSGQRAIYHGLGLTGIPITNVNNNCATGSTALFMARQLVEGGLANCVLALGFERMAKGSLASGFSDRTNPIDKHLEIMINKYGLASAPVAPQMFANAGKEHMEKYGTNPEYFAKIAWKNHSHSTNNPYSQFQKEYTLDEVLHSRKIFDFLTVLQCCPTSNGAAAAVLASEEFVKKRKLQPKAVEILAQVMVTDYPSTFEENSCMKLVGYDMTKKAAEKCFEKAGLKPTDVDVIELHDCFSVNELITYEALGLCPEGRACDLIDRGDNTYGGKWVINPSGGLISKGHPLGATGLAQCAELCWQLRGLAGRRQVPGAKVALQHNLGVGGAVVVTLYGMGFPGAASTGRIAAVPLSAAVEGFKSHLVFKEIEKKLQEEGEQYVKKIGGVFAFKIKGGPGGKEATWIVDVKNGKGSVAVNSDKKADCTITMADTDLLALMTGKMNPQTAFFQGKLKVSGNMGMAMKLQNLQLQPGKAKL",
"proteome": "UP000519115",
"gene": "Scp2",
"go_terms": [
{
"identifier": "GO:0016746",
"name": "acyltransferase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0016747",
"name": "acyltransferase activity, transferring groups other than amino-acyl groups",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 4,
"source_database": "unreviewed",
"is_fragment": true,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "2439a6bccc43aa4dc3392b487f93078cdae62632",
"counters": {
"domain_architectures": 1551,
"entries": 19,
"isoforms": 0,
"proteomes": 1,
"sets": 3,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cdd": 1,
"cathgene3d": 2,
"pfam": 3,
"ssf": 2,
"ncbifam": 1,
"panther": 1,
"prosite": 2,
"interpro": 7
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 1551
}
}
}