General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A7K9B3S1",
        "id": "A0A7K9B3S1_DRONO",
        "source_organism": {
            "taxId": "8790",
            "scientificName": "Dromaius novaehollandiae",
            "fullName": "Dromaius novaehollandiae (Emu)"
        },
        "name": "Small muscular protein",
        "description": [
            "Plays a role in the regulatory network through which muscle cells coordinate their structural and functional states during growth, adaptation, and repair"
        ],
        "length": 76,
        "sequence": "QANINIPMGAFRPGAGHPHKRKEFTPEVEESVPASTEEEKDKKHLPGAKKLPGPAVNLSEIQNIKSELKFVPKAEQ",
        "proteome": null,
        "gene": "Smpx",
        "go_terms": null,
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": true,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "958c0d314c17c411010c5d8e8b9425b2fda9d420",
        "counters": {
            "domain_architectures": 798,
            "entries": 3,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "pfam": 1,
                "panther": 1,
                "interpro": 1
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 798
        }
    }
}