GET /api/protein/UniProt/A0A7K9B3S1/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A7K9B3S1",
"id": "A0A7K9B3S1_DRONO",
"source_organism": {
"taxId": "8790",
"scientificName": "Dromaius novaehollandiae",
"fullName": "Dromaius novaehollandiae (Emu)"
},
"name": "Small muscular protein",
"description": [
"Plays a role in the regulatory network through which muscle cells coordinate their structural and functional states during growth, adaptation, and repair"
],
"length": 76,
"sequence": "QANINIPMGAFRPGAGHPHKRKEFTPEVEESVPASTEEEKDKKHLPGAKKLPGPAVNLSEIQNIKSELKFVPKAEQ",
"proteome": null,
"gene": "Smpx",
"go_terms": null,
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": true,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "958c0d314c17c411010c5d8e8b9425b2fda9d420",
"counters": {
"domain_architectures": 798,
"entries": 3,
"isoforms": 0,
"proteomes": 0,
"sets": 0,
"structures": 0,
"taxa": 1,
"dbEntries": {
"pfam": 1,
"panther": 1,
"interpro": 1
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 798
}
}
}