General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A7K7QTY6",
        "id": "A0A7K7QTY6_POEAT",
        "source_organism": {
            "taxId": "48891",
            "scientificName": "Poecile atricapillus",
            "fullName": "Poecile atricapillus (Black-capped chickadee)"
        },
        "name": "Ubiquitin-like-conjugating enzyme ATG10",
        "description": [
            "E2-like enzyme involved in autophagy. Acts as an E2-like enzyme that catalyzes the conjugation of ATG12 to ATG5. ATG12 conjugation to ATG5 is required for autophagy. Likely serves as an ATG5-recognition molecule. Not involved in ATG12 conjugation to ATG3. Plays a role in adenovirus-mediated cell lysis"
        ],
        "length": 228,
        "sequence": "VRCGMAGEEGFFLEEKRFKQCCEDFVKHSQQIGDGWEWRASKDLGDGYLSKTHFQVRNRHIPPDLKEKNSDNTEEMLLAHVEEPWDDSQAAGVCGTEEVVRYEYHVLYSSSYQVPVLYFRACFLDGRPLSLDEIWGSVHASYQARLQEGPWDTITQQEHPILGQPFFVLHPCRTNEFISAVLGSSQEHHRHTNYIILWLSTVGPVVGLNLPLSYAKAASEQSTDLAER",
        "proteome": "UP000540071",
        "gene": "Atg10",
        "go_terms": [
            {
                "identifier": "GO:0019787",
                "name": "ubiquitin-like protein transferase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": true,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "fc7bdabffd8b733f2090e8c405b0e669ecaf8846",
        "counters": {
            "domain_architectures": 8524,
            "entries": 4,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "pfam": 1,
                "panther": 1,
                "interpro": 1
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 8524
        }
    }
}