HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A7K7NQV2",
"id": "A0A7K7NQV2_HALAL",
"source_organism": {
"taxId": "8969",
"scientificName": "Haliaeetus albicilla",
"fullName": "Haliaeetus albicilla (White-tailed sea-eagle)"
},
"name": "Platelet-derived growth factor subunit B",
"description": [
"Growth factor that plays an essential role in the regulation of embryonic development, cell proliferation, cell migration, survival and chemotaxis. Potent mitogen for cells of mesenchymal origin. Required for normal proliferation and recruitment of pericytes and vascular smooth muscle cells in the central nervous system, skin, lung, heart and placenta. Required for normal blood vessel development, and for normal development of kidney glomeruli. Plays an important role in wound healing. Signaling is modulated by the formation of heterodimers with PDGFA"
],
"length": 222,
"sequence": "QGDPIPEDIYEILGGSSVRSISDLQRALRIDSVEEDSSSLDLNATQPSQNPMALSRERRSLDALAAAEPAVLAECKTRAVVFEISRNMVDSTNANFVVWPPCVEVQRCSGCCNNRNVQCRPTQIRVRHVQVNKIEFVQRKPKFKKVVVPLEDHVQCRCEAVSRQPPRNSRPGPREQRRLSPSFTTAAVSQRRRVRRPPAQKRKHKKYKHVNDKKVLKEILIA",
"proteome": "UP000585422",
"gene": "Pdgfb",
"go_terms": [
{
"identifier": "GO:0008083",
"name": "growth factor activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0016020",
"name": "membrane",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": true,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "b9876a382d1187221806a8deed9f3f715763252c",
"counters": {
"domain_architectures": 2203,
"entries": 13,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"profile": 1,
"ssf": 1,
"cdd": 1,
"smart": 1,
"pfam": 2,
"panther": 1,
"prosite": 1,
"interpro": 4
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 2203
}
}
}