HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A7K7MZC8",
"id": "A0A7K7MZC8_HALAL",
"source_organism": {
"taxId": "8969",
"scientificName": "Haliaeetus albicilla",
"fullName": "Haliaeetus albicilla (White-tailed sea-eagle)"
},
"name": "ACHA protein",
"description": [
"Upon acetylcholine binding, the AChR responds by an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane"
],
"length": 445,
"sequence": "SAAGLALCYEHETRLVEDLFRDYNKVVRPVEDHRDAVVVTVGLQLIQLISVDEVNQIVTTNVRLKQQWTDVNLKWNPDDYGGVKKIRIPSDDIWRPDLVLYNNADGDFAIVKYTKVLLEHTGLITWTPPAIFKSYCEIIVTHFPFDQQNCSMKLGTWTYDGTMVVINPESDRPDLSNFMESGEWVMKDYRGWKHWVYYACCPDTPYLDITYHFLMQRLPLYFIVNVIIPCLLFSFLTGLVFYLPTDSGEKMTLSISVLLSLTVFLLVIVELIPSTSSAVPLIGKYMLFTMVFVIASIIITVIVINTHHRSPSTHTMPHWVRKIFIDTIPNIMFFSTMKRPSRDKQDKNIFAEDIDISEISGKPGSVPVNFYSPLTKNPDVKNAIEGIKYIAETMKSDQEASNAAEEWKFVAMVVDHLLLGIFMLVCIIGTLAVFAGRLIELNQQG",
"proteome": "UP000585422",
"gene": "Chrna1",
"go_terms": [
{
"identifier": "GO:0005230",
"name": "extracellular ligand-gated monoatomic ion channel activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006811",
"name": "monoatomic ion transport",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0016020",
"name": "membrane",
"category": {
"code": "C",
"name": "cellular_component"
}
},
{
"identifier": "GO:0004888",
"name": "transmembrane signaling receptor activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0005216",
"name": "monoatomic ion channel activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0034220",
"name": "monoatomic ion transmembrane transport",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0022848",
"name": "acetylcholine-gated monoatomic cation-selective channel activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0045211",
"name": "postsynaptic membrane",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": true,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "f0f65eb78714613543b62ad4efdee53cc781e40a",
"counters": {
"domain_architectures": 69545,
"entries": 21,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 2,
"cdd": 2,
"ssf": 2,
"ncbifam": 1,
"pfam": 2,
"panther": 1,
"prosite": 1,
"prints": 2,
"interpro": 8
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 69545
}
}
}