GET /api/protein/UniProt/A0A7K7MZC8/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A7K7MZC8",
        "id": "A0A7K7MZC8_HALAL",
        "source_organism": {
            "taxId": "8969",
            "scientificName": "Haliaeetus albicilla",
            "fullName": "Haliaeetus albicilla (White-tailed sea-eagle)"
        },
        "name": "ACHA protein",
        "description": [
            "Upon acetylcholine binding, the AChR responds by an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane"
        ],
        "length": 445,
        "sequence": "SAAGLALCYEHETRLVEDLFRDYNKVVRPVEDHRDAVVVTVGLQLIQLISVDEVNQIVTTNVRLKQQWTDVNLKWNPDDYGGVKKIRIPSDDIWRPDLVLYNNADGDFAIVKYTKVLLEHTGLITWTPPAIFKSYCEIIVTHFPFDQQNCSMKLGTWTYDGTMVVINPESDRPDLSNFMESGEWVMKDYRGWKHWVYYACCPDTPYLDITYHFLMQRLPLYFIVNVIIPCLLFSFLTGLVFYLPTDSGEKMTLSISVLLSLTVFLLVIVELIPSTSSAVPLIGKYMLFTMVFVIASIIITVIVINTHHRSPSTHTMPHWVRKIFIDTIPNIMFFSTMKRPSRDKQDKNIFAEDIDISEISGKPGSVPVNFYSPLTKNPDVKNAIEGIKYIAETMKSDQEASNAAEEWKFVAMVVDHLLLGIFMLVCIIGTLAVFAGRLIELNQQG",
        "proteome": "UP000585422",
        "gene": "Chrna1",
        "go_terms": [
            {
                "identifier": "GO:0005230",
                "name": "extracellular ligand-gated monoatomic ion channel activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006811",
                "name": "monoatomic ion transport",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0016020",
                "name": "membrane",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            },
            {
                "identifier": "GO:0004888",
                "name": "transmembrane signaling receptor activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0005216",
                "name": "monoatomic ion channel activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0034220",
                "name": "monoatomic ion transmembrane transport",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0022848",
                "name": "acetylcholine-gated monoatomic cation-selective channel activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0045211",
                "name": "postsynaptic membrane",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": true,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "f0f65eb78714613543b62ad4efdee53cc781e40a",
        "counters": {
            "domain_architectures": 69545,
            "entries": 21,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 2,
                "cdd": 2,
                "ssf": 2,
                "ncbifam": 1,
                "pfam": 2,
                "panther": 1,
                "prosite": 1,
                "prints": 2,
                "interpro": 8
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 69545
        }
    }
}