General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A7K7CDM1",
        "id": "A0A7K7CDM1_APHCE",
        "source_organism": {
            "taxId": "39617",
            "scientificName": "Aphelocoma coerulescens",
            "fullName": "Aphelocoma coerulescens (Florida scrub-jay)"
        },
        "name": "UDP-glucose 4-epimerase",
        "description": [
            "Catalyzes two distinct but analogous reactions: the reversible epimerization of UDP-glucose to UDP-galactose and the reversible epimerization of UDP-N-acetylglucosamine to UDP-N-acetylgalactosamine. The reaction with UDP-Gal plays a critical role in the Leloir pathway of galactose catabolism in which galactose is converted to the glycolytic intermediate glucose 6-phosphate. It contributes to the catabolism of dietary galactose and enables the endogenous biosynthesis of both UDP-Gal and UDP-GalNAc when exogenous sources are limited. Both UDP-sugar interconversions are important in the synthesis of glycoproteins and glycolipids"
        ],
        "length": 375,
        "sequence": "QGAMAEKILVTGGAGYIGSHCVLELLQAGYVPVVIDNFHNAIRGSEELPESLRRVQDIVHQPVLFQELDITDEAALQELFRKHRFSAVMHFAGLKAVGESVQKPLEYYRVNLTGTIRLLETMKAHGVRNIVFSSSATVYGDPKYLPLDEKHPVGGCTNPYGKSKFFIEEMIRDLCKAERDWNAVLLRYFNPIGAHESGMIGEDPQGIPNNLMPYVAQVAVGRREFLSVFGNDYKTDDGTGASRDGRNFRFPNPWLHPGLCPHPLHPPGVRDYIHVVDLAKGHIAALKKLKENCGCKVYNLGTGTGYSVLQMVRAMEKASGREIKYQITARREGDVASCYADPALAERELGWKAAFGLDKMCKGIPSLARWALPDP",
        "proteome": "UP000575874",
        "gene": "Gale",
        "go_terms": [
            {
                "identifier": "GO:0003978",
                "name": "UDP-glucose 4-epimerase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006012",
                "name": "galactose metabolic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": true,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "d2eb2fbd63cfbf5e01dcf985088804d0b8dd1eb2",
        "counters": {
            "domain_architectures": 564,
            "entries": 11,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "cdd": 1,
                "cathgene3d": 2,
                "pfam": 1,
                "panther": 1,
                "ncbifam": 1,
                "prints": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 564
        }
    }
}