GET /api/protein/UniProt/A0A7K6XNU6/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A7K6XNU6",
        "id": "A0A7K6XNU6_9PASE",
        "source_organism": {
            "taxId": "254652",
            "scientificName": "Promerops cafer",
            "fullName": "Promerops cafer (Cape sugarbird)"
        },
        "name": "Leptin receptor overlapping transcript-like 1",
        "description": [
            "Negatively regulates growth hormone (GH) receptor cell surface expression in liver. May play a role in liver resistance to GH during periods of reduced nutrient availability"
        ],
        "length": 131,
        "sequence": "FVLVVALISLSFGGAVGLMFLMLGCALPQYNQYWPLFVLFFYILSPIPYCIARRLVDDTDATSNACKELAIFLTTGIVVSAFGLPIVFARAELIYWGACALVLTGNTVIFATILGFFLVFGSNDDFSWQQW",
        "proteome": "UP000587587",
        "gene": "Leprotl1",
        "go_terms": null,
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": true,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "443a18aff7c840205fb1b4f44a2ca854efb30db9",
        "counters": {
            "domain_architectures": 5632,
            "entries": 3,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "panther": 1,
                "pfam": 1,
                "interpro": 1
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 5632
        }
    }
}