General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A7K6TIL0",
        "id": "A0A7K6TIL0_CALNI",
        "source_organism": {
            "taxId": "187106",
            "scientificName": "Caloenas nicobarica",
            "fullName": "Caloenas nicobarica (Nicobar pigeon)"
        },
        "name": "Histone H2A",
        "description": [
            "Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling"
        ],
        "length": 135,
        "sequence": "RMSGRGKKHAAAGKPGAAPKQNKSARAGLQFPVGRIYGLLKRGNYSERISPGAAIYLTAVLEYLTAEIIELVGNAAWENKKKRITPRHIQLAVRNDDELNKIFCCVTIAEGGVLPNILSQLLPKKTARDSVSSQE",
        "proteome": "UP000546235",
        "gene": "Hta2",
        "go_terms": [
            {
                "identifier": "GO:0046982",
                "name": "protein heterodimerization activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0003677",
                "name": "DNA binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0030527",
                "name": "structural constituent of chromatin",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0000786",
                "name": "nucleosome",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": true,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "de63b9b1b29a88c0202d646316133c44fdb4ad35",
        "counters": {
            "domain_architectures": 25209,
            "entries": 15,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "smart": 1,
                "ssf": 1,
                "pfam": 2,
                "cdd": 1,
                "panther": 1,
                "prosite": 1,
                "prints": 1,
                "interpro": 6
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 25209
        }
    }
}