HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A7K6L6C0",
"id": "A0A7K6L6C0_9CORV",
"source_organism": {
"taxId": "254539",
"scientificName": "Falcunculus frontatus",
"fullName": "Falcunculus frontatus (Eastern shriketit)"
},
"name": "DNA-directed RNA polymerase subunit",
"description": [
"DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Specific peripheric component of RNA polymerase III (Pol III) which synthesizes small non-coding RNAs including 5S rRNA, snRNAs, tRNAs and miRNAs from at least 500 distinct genomic loci. With CRCP/RPC9 forms a mobile stalk that protrudes from Pol III core and functions primarily in transcription initiation. Pol III plays a key role in sensing and limiting infection by intracellular bacteria and DNA viruses. Acts as nuclear and cytosolic DNA sensor involved in innate immune response. Can sense non-self dsDNA that serves as template for transcription into dsRNA. The non-self RNA polymerase III transcripts, such as Epstein-Barr virus-encoded RNAs (EBERs) induce type I interferon and NF-kappa-B through the RIG-I pathway",
"DNA-dependent RNA polymerase which catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates"
],
"length": 206,
"sequence": "MFVLVEMTDTVRIPPWQFERKLNESIAEELNKKLANKVVYNVGLCICLYDITKLEDSYIFPGDGASHTKVHFRYVVFHPFLDEILIGQIKSCSQDGVHVSIGFFDDIVIPPESLQQPAKFDEAEQVWVWEYETEEGAHDLYMDIGEEIRFRVVDETFVDTSPTGPSSAEASTSSAAEEVQKKEAPYTLVGSISEPGLGLLSWWTNS",
"proteome": "UP000534626",
"gene": "Polr3h",
"go_terms": [
{
"identifier": "GO:0006351",
"name": "DNA-templated transcription",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0003677",
"name": "DNA binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0003899",
"name": "DNA-directed RNA polymerase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006352",
"name": "DNA-templated transcription initiation",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": true,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "fd05722550f5a454a1e6be8aa835c4de81dde895",
"counters": {
"domain_architectures": 3909,
"entries": 15,
"isoforms": 0,
"proteomes": 1,
"sets": 3,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 2,
"cathgene3d": 2,
"cdd": 1,
"pfam": 2,
"ncbifam": 1,
"panther": 1,
"interpro": 6
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 3909
}
}
}