GET /api/protein/UniProt/A0A7J9B6E8/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A7J9B6E8",
"id": "A0A7J9B6E8_GOSGO",
"source_organism": {
"taxId": "34282",
"scientificName": "Gossypium gossypioides",
"fullName": "Gossypium gossypioides (Mexican cotton)"
},
"name": "PHD finger protein ALFIN-LIKE",
"description": [
"Histone-binding component that specifically recognizes H3 tails trimethylated on 'Lys-4' (H3K4me3), which mark transcription start sites of virtually all active genes"
],
"length": 170,
"sequence": "MQERDWLSLVAVHSDAWLLSLAFYFGARFGFYNTDRERLFNMINDLPTIFEVVTGSAKKHTKEKSSVSNHNSKKSKSNSKQGSEAQTKYSKAVPSQDEVDDGIEEEDEDEHGEALCGACGENYADDEFWICCDICEKWFHGKCVKITPARAEHIKQYKCPSCSGNKSARP",
"proteome": "UP000593579",
"gene": "Gogos_016038",
"go_terms": [
{
"identifier": "GO:0042393",
"name": "histone binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006355",
"name": "regulation of DNA-templated transcription",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": true,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "79fa3a3b3631d4868e7b90bb6b4ef81297940df8",
"counters": {
"domain_architectures": 4289,
"entries": 17,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"profile": 1,
"smart": 1,
"cdd": 1,
"pfam": 2,
"panther": 1,
"prosite": 1,
"interpro": 8
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 4289
}
}
}