General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A7J8KCU0",
        "id": "A0A7J8KCU0_ROUAE",
        "source_organism": {
            "taxId": "9407",
            "scientificName": "Rousettus aegyptiacus",
            "fullName": "Rousettus aegyptiacus (Egyptian fruit bat)"
        },
        "name": "Myelin-oligodendrocyte glycoprotein",
        "description": [
            "Minor component of the myelin sheath. May be involved in completion and/or maintenance of the myelin sheath and in cell-cell communication. Mediates homophilic cell-cell adhesion"
        ],
        "length": 207,
        "sequence": "MASFLSSLLPSCLSCLLLLLQLSSSYAGQFRVIGPGHPIRALVGDEVELPCRILPGRNATGMEVGWYRPPFSRVVHLYRNGKDQDGEQAPEYRGRTELLKETIGEGKVTLRIRKVRFSDEGGFTCFFRDHSYQEEVAMELKVEGKLRAEIENLHRTFDPHFLRVPCWKITLFVIVPVLGPLVALIICYNWLHRRLAGQFLEELRNPF",
        "proteome": "UP000593571",
        "gene": "HJG63_013436",
        "go_terms": null,
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "5ed7c00baee6d5d5484012bbe9c8560ea78da669",
        "counters": {
            "domain_architectures": 138160,
            "entries": 16,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "cdd": 1,
                "ssf": 1,
                "smart": 2,
                "pfam": 1,
                "profile": 1,
                "pirsf": 1,
                "panther": 1,
                "interpro": 7
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 138160
        }
    }
}