GET /api/protein/UniProt/A0A7J8K3V3/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A7J8K3V3",
        "id": "A0A7J8K3V3_MOLMO",
        "source_organism": {
            "taxId": "27622",
            "scientificName": "Molossus molossus",
            "fullName": "Molossus molossus (Pallas' mastiff bat)"
        },
        "name": "tRNA (adenine(58)-N(1))-methyltransferase catalytic subunit TRMT61A",
        "description": [
            "Catalytic subunit of tRNA (adenine-N(1)-)-methyltransferase, which catalyzes the formation of N(1)-methyladenine at position 58 (m1A58) in initiator methionyl-tRNA. Catalytic subunit of mRNA N(1)-methyltransferase complex, which mediates methylation of adenosine residues at the N(1) position of a small subset of mRNAs: N(1) methylation takes place in tRNA T-loop-like structures of mRNAs and is only present at low stoichiometries"
        ],
        "length": 285,
        "sequence": "MSFVAYEELIKEGDTAILSLGHGAMVAVRVQRGAQTQTRHGVLRHSVDLIGRPFGSKVTCGRGGWVYVLHPTPELWTLNLPHRTQILYSTDIALLTMMLELRPGSVVCESGTGSGSVSHAIIRTIAPTGHLHTVEFHQQRAEKAREEFQEHRVGRWVTVRNQDVCRSGFGVSHVADAVFLDIPSPWEAVGHAWDALRVEGGRFCSFSPCIEQVQRTCQALAARGFSELSTVEALPQVYTVRTVSLPSPDLGAGPGPDASPFRSGTPMKETVGHTGYLTFATKTPD",
        "proteome": "UP000550707",
        "gene": "HJG59_018823",
        "go_terms": [
            {
                "identifier": "GO:0160107",
                "name": "tRNA (adenine(58)-N1)-methyltransferase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0030488",
                "name": "tRNA methylation",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0031515",
                "name": "tRNA (m1A) methyltransferase complex",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "fdf0a68307edf34659e7747ebff507847f3fdd35",
        "counters": {
            "domain_architectures": 4969,
            "entries": 10,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 2,
                "ssf": 1,
                "profile": 1,
                "panther": 1,
                "pirsf": 1,
                "pfam": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 4969
        }
    }
}