HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A7J8J9E6",
"id": "A0A7J8J9E6_ROUAE",
"source_organism": {
"taxId": "9407",
"scientificName": "Rousettus aegyptiacus",
"fullName": "Rousettus aegyptiacus (Egyptian fruit bat)"
},
"name": "Alkylglycerone-phosphate synthase",
"description": [
"Catalyzes the exchange of an acyl for a long-chain alkyl group and the formation of the ether bond in the biosynthesis of ether phospholipids"
],
"length": 185,
"sequence": "MAEAVAAAGGMGAGSDCDADRDRDPDRDRAGRRLRVLSGHLLSRPQGALSTNECKARRAPSAATAAPTATPAAQESGTIPKKRQEVMKWNGWGYNDSKFFFNKKGQIELTGKRGISDPLTVFEQTEAAAREEILANGGSLSHHHGVGKLRKQWLKESISDVGFGMLKSVKEYVDPNNIFGNRNLL",
"proteome": "UP000593571",
"gene": "HJG63_000452",
"go_terms": [
{
"identifier": "GO:0003824",
"name": "catalytic activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0050660",
"name": "flavin adenine dinucleotide binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0008609",
"name": "alkylglycerone-phosphate synthase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0008610",
"name": "lipid biosynthetic process",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "ba9e5f6e0d35ab952b0d19ace143fff500c02a8b",
"counters": {
"domain_architectures": 2499,
"entries": 10,
"isoforms": 0,
"proteomes": 1,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 2,
"ssf": 1,
"pfam": 1,
"panther": 1,
"interpro": 5
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 2499
}
}
}