General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A7J8J9E6",
        "id": "A0A7J8J9E6_ROUAE",
        "source_organism": {
            "taxId": "9407",
            "scientificName": "Rousettus aegyptiacus",
            "fullName": "Rousettus aegyptiacus (Egyptian fruit bat)"
        },
        "name": "Alkylglycerone-phosphate synthase",
        "description": [
            "Catalyzes the exchange of an acyl for a long-chain alkyl group and the formation of the ether bond in the biosynthesis of ether phospholipids"
        ],
        "length": 185,
        "sequence": "MAEAVAAAGGMGAGSDCDADRDRDPDRDRAGRRLRVLSGHLLSRPQGALSTNECKARRAPSAATAAPTATPAAQESGTIPKKRQEVMKWNGWGYNDSKFFFNKKGQIELTGKRGISDPLTVFEQTEAAAREEILANGGSLSHHHGVGKLRKQWLKESISDVGFGMLKSVKEYVDPNNIFGNRNLL",
        "proteome": "UP000593571",
        "gene": "HJG63_000452",
        "go_terms": [
            {
                "identifier": "GO:0003824",
                "name": "catalytic activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0050660",
                "name": "flavin adenine dinucleotide binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0008609",
                "name": "alkylglycerone-phosphate synthase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0008610",
                "name": "lipid biosynthetic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "ba9e5f6e0d35ab952b0d19ace143fff500c02a8b",
        "counters": {
            "domain_architectures": 2499,
            "entries": 10,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 2,
                "ssf": 1,
                "pfam": 1,
                "panther": 1,
                "interpro": 5
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 2499
        }
    }
}