HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A7J8GPQ5",
"id": "A0A7J8GPQ5_MOLMO",
"source_organism": {
"taxId": "27622",
"scientificName": "Molossus molossus",
"fullName": "Molossus molossus (Pallas' mastiff bat)"
},
"name": "Colipase",
"description": [
"Colipase is a cofactor of pancreatic lipase. It allows the lipase to anchor itself to the lipid-water interface. Without colipase the enzyme is washed off by bile salts, which have an inhibitory effect on the lipase",
"Enterostatin has a biological activity as a satiety signal"
],
"length": 119,
"sequence": "MEKILVLLLVTLAVAYAVPDPRGIIVNLEEGELCLNSAQCKSKCCHRPGGLTLARCAPKASENSECSAKTLYGVYYKCPCERGLTCEVDKTIVGSITNTNFGTCQDPGRSKENQPPSTP",
"proteome": "UP000550707",
"gene": "HJG59_003010",
"go_terms": [
{
"identifier": "GO:0008047",
"name": "enzyme activator activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0007586",
"name": "digestion",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0016042",
"name": "lipid catabolic process",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0005576",
"name": "extracellular region",
"category": {
"code": "C",
"name": "cellular_component"
}
},
{
"identifier": "GO:0035473",
"name": "lipase binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0043085",
"name": "positive regulation of catalytic activity",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 4,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "bfb4eac5015bff5fae376e9561605f5cfc55cf37",
"counters": {
"domain_architectures": 632,
"entries": 15,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 1,
"smart": 1,
"cathgene3d": 1,
"pfam": 2,
"cdd": 1,
"profile": 1,
"panther": 1,
"prints": 1,
"prosite": 1,
"interpro": 5
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 632
}
}
}