GET /api/protein/UniProt/A0A7J8GGE6/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A7J8GGE6",
"id": "A0A7J8GGE6_ROUAE",
"source_organism": {
"taxId": "9407",
"scientificName": "Rousettus aegyptiacus",
"fullName": "Rousettus aegyptiacus (Egyptian fruit bat)"
},
"name": "Scavenger receptor class F member 1",
"description": [
"Mediates the binding and degradation of acetylated low density lipoprotein (Ac-LDL). Mediates heterophilic interactions, suggesting a function as adhesion protein. Plays a role in the regulation of neurite-like outgrowth"
],
"length": 477,
"sequence": "MVLWLLLPLLLLWIQGTQESKLDPNGQHVCKTNSSSAELQCCPGWRQKDQECTIPICEGTDACQEDEVCVKPGLCRCKPGFFGFQCKSRCPGQYWGPDCRESCACYPHGQCEPDTGVCHCQADRWGSRCEFACACSSHGRCDPQTGACRCEPGWWSTTCRRRCQCNQGAVRCDQATGSCLCEAGWWGHRCSFRCPCHGSPCAQDSGRCTCLPGWWGPECRDRCECVRGRCSATSGQCACPPGFSGVRCELLCPAGHYGAQCRHSCGHCKRNEPCSADTGSCESCEPGWNGTQCHQPCPPGTFGESCRQQCPRCWLGEACQPDTGHCQSCDPGWLGPSCEDPCPSGTFGKGCGSTCPTCVQGACDAMTGECVCNAGYWGPSCNISCPSGFYGNNCSVPCECPEGPCHPVSGVCQLGSHSQDAALIAGILVPLLLLLLGIACCACCCWANRLDPKDRDGPYDPTRVTGGQSGWRSLPSP",
"proteome": "UP000593571",
"gene": "HJG63_017212",
"go_terms": [
{
"identifier": "GO:0005044",
"name": "scavenger receptor activity",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 4,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "8a0e4fad86badc5242571b8e0b892ab5626491e5",
"counters": {
"domain_architectures": 396,
"entries": 16,
"isoforms": 0,
"proteomes": 1,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 2,
"smart": 2,
"pfam": 2,
"profile": 1,
"ssf": 1,
"panther": 1,
"prosite": 1,
"prints": 1,
"interpro": 5
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 396
}
}
}