General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A7J8GGE6",
        "id": "A0A7J8GGE6_ROUAE",
        "source_organism": {
            "taxId": "9407",
            "scientificName": "Rousettus aegyptiacus",
            "fullName": "Rousettus aegyptiacus (Egyptian fruit bat)"
        },
        "name": "Scavenger receptor class F member 1",
        "description": [
            "Mediates the binding and degradation of acetylated low density lipoprotein (Ac-LDL). Mediates heterophilic interactions, suggesting a function as adhesion protein. Plays a role in the regulation of neurite-like outgrowth"
        ],
        "length": 477,
        "sequence": "MVLWLLLPLLLLWIQGTQESKLDPNGQHVCKTNSSSAELQCCPGWRQKDQECTIPICEGTDACQEDEVCVKPGLCRCKPGFFGFQCKSRCPGQYWGPDCRESCACYPHGQCEPDTGVCHCQADRWGSRCEFACACSSHGRCDPQTGACRCEPGWWSTTCRRRCQCNQGAVRCDQATGSCLCEAGWWGHRCSFRCPCHGSPCAQDSGRCTCLPGWWGPECRDRCECVRGRCSATSGQCACPPGFSGVRCELLCPAGHYGAQCRHSCGHCKRNEPCSADTGSCESCEPGWNGTQCHQPCPPGTFGESCRQQCPRCWLGEACQPDTGHCQSCDPGWLGPSCEDPCPSGTFGKGCGSTCPTCVQGACDAMTGECVCNAGYWGPSCNISCPSGFYGNNCSVPCECPEGPCHPVSGVCQLGSHSQDAALIAGILVPLLLLLLGIACCACCCWANRLDPKDRDGPYDPTRVTGGQSGWRSLPSP",
        "proteome": "UP000593571",
        "gene": "HJG63_017212",
        "go_terms": [
            {
                "identifier": "GO:0005044",
                "name": "scavenger receptor activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 4,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "8a0e4fad86badc5242571b8e0b892ab5626491e5",
        "counters": {
            "domain_architectures": 396,
            "entries": 16,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 2,
                "smart": 2,
                "pfam": 2,
                "profile": 1,
                "ssf": 1,
                "panther": 1,
                "prosite": 1,
                "prints": 1,
                "interpro": 5
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 396
        }
    }
}