GET /api/protein/UniProt/A0A7J8FQT4/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A7J8FQT4",
"id": "A0A7J8FQT4_MOLMO",
"source_organism": {
"taxId": "27622",
"scientificName": "Molossus molossus",
"fullName": "Molossus molossus (Pallas' mastiff bat)"
},
"name": "D-2-hydroxyglutarate dehydrogenase, mitochondrial",
"description": [
"Catalyzes the oxidation of D-2-hydroxyglutarate (D-2-HG) to alpha-ketoglutarate. Also catalyzes the oxidation of other D-2-hydroxyacids, such as D-malate (D-MAL) and D-lactate (D-LAC). Exhibits high activities towards D-2-HG and D-MAL but a very weak activity towards D-LAC"
],
"length": 326,
"sequence": "MPLDLGAKGSCHIGGNLATNAGGLRFLRYGSLRGTVLGLEVVLADGTVLNCLTSLRKDNTGYDLKQLFIGSEGTLGVITAVSILCPPKPGAVNVAFLGCPGFAEVLQTFSTCKRMLGEILSAYEFMDAECMQLVGHHLRLARPVQESPFYVLVETSGSRAEHDAEKLSSFLEHVLGCGLVTDGTLATDQRKIKTLWALRERITEALSRDGYVYKYDLSLPVDRLYDLVTDLRARLGPRARHVVGYGHLGDGNLHLNVTAEAFSAALLGELEPYVYQWTAGQRGSVSAEHGVGFKKQSVLGYSKPPEALRLMQQLKALLDPRGLLNP",
"proteome": "UP000550707",
"gene": "HJG59_003624",
"go_terms": [
{
"identifier": "GO:0071949",
"name": "FAD binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0050660",
"name": "flavin adenine dinucleotide binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0003824",
"name": "catalytic activity",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "7b22dd38be3a0e6997fe24cb0e6fe943f209805a",
"counters": {
"domain_architectures": 57688,
"entries": 18,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"profile": 1,
"cathgene3d": 4,
"pfam": 2,
"ssf": 2,
"panther": 1,
"interpro": 8
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 57688
}
}
}