GET /api/protein/UniProt/A0A7J8F5X5/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A7J8F5X5",
        "id": "A0A7J8F5X5_MOLMO",
        "source_organism": {
            "taxId": "27622",
            "scientificName": "Molossus molossus",
            "fullName": "Molossus molossus (Pallas' mastiff bat)"
        },
        "name": "Antizyme inhibitor 2",
        "description": [
            "Antizyme inhibitor (AZI) protein that positively regulates ornithine decarboxylase (ODC) activity and polyamine uptake. AZI is an enzymatically inactive ODC homolog that counteracts the negative effect of ODC antizymes (AZs) OAZ1, OAZ2 and OAZ3 on ODC activity by competing with ODC for antizyme-binding. Inhibits antizyme-dependent ODC degradation and releases ODC monomers from their inactive complex with antizymes, leading to formation of the catalytically active ODC homodimer and restoring polyamine production. Participates in the morphological integrity of the trans-Golgi network (TGN) and functions as a regulator of intracellular secretory vesicle trafficking"
        ],
        "length": 239,
        "sequence": "MGAELGHRMHILDLGGSFPGVEGAKVRFEEIASVINSALDLYFPEGCGVDILAKLGRYYVTSAFTLAVSIIAKKEVLLDQPGREEETDSAPKTITYHLDEGIYGIFNSVLFDNTCPTPVLQKKPPTEQPWYSSSLWGPAADGCDCVAEGLWLPQLHVGDWLVFENMGAYTVGMGSLFRGTQTCRITYAMSRVAWKALREQLLPAEQDEDAEGVCKPLSCGWEITDTLCVGPVFTPASIM",
        "proteome": "UP000550707",
        "gene": "HJG59_001313",
        "go_terms": [
            {
                "identifier": "GO:0003824",
                "name": "catalytic activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006596",
                "name": "polyamine biosynthetic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "7e1d1e72aff0434b7e43c969eb9a2353656ea60b",
        "counters": {
            "domain_architectures": 5554,
            "entries": 12,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 2,
                "ssf": 1,
                "pfam": 1,
                "panther": 1,
                "prints": 2,
                "interpro": 5
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 5554
        }
    }
}