General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A7J8DUI5",
        "id": "A0A7J8DUI5_MOLMO",
        "source_organism": {
            "taxId": "27622",
            "scientificName": "Molossus molossus",
            "fullName": "Molossus molossus (Pallas' mastiff bat)"
        },
        "name": "Proenkephalin-A",
        "description": [
            "Neuropeptide that competes with and mimic the effects of opiate drugs. They play a role in a number of physiologic functions, including pain perception and responses to stress"
        ],
        "length": 266,
        "sequence": "MARFLRLCTWLLALGPGLLATVRAECSQDCATCSYRLARPTDLNPLACTLECEGKLPSLNTWKVCKELLQLSNPELPQDGTSALRESSRQEESHLLAKKYGGFMKRYGGFMKKMDELYPLEPEEEADGGENLAKRYGGFMKKDADEGDTLGNSLDPLKELLGTGDNRESSHHQEGSDDDEEVNKRYGGFMRGLKRSPQLEDEAKELQKRYGGFMRRVGRPEWWMDYQKRYGGFLKRFADSVPSNEGEGYSKEVPEMEKRYGGFMRF",
        "proteome": "UP000550707",
        "gene": "HJG59_014056",
        "go_terms": [
            {
                "identifier": "GO:0007218",
                "name": "neuropeptide signaling pathway",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "6fa08cbd40ae6cd5bb2038f6d2313e3785d0712e",
        "counters": {
            "domain_architectures": 2355,
            "entries": 7,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "panther": 1,
                "pfam": 1,
                "prints": 2,
                "prosite": 1,
                "interpro": 2
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 2355
        }
    }
}