GET /api/protein/UniProt/A0A7J8DTV4/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A7J8DTV4",
        "id": "A0A7J8DTV4_MOLMO",
        "source_organism": {
            "taxId": "27622",
            "scientificName": "Molossus molossus",
            "fullName": "Molossus molossus (Pallas' mastiff bat)"
        },
        "name": "Protein odd-skipped-related 2",
        "description": [
            "May be involved in the development of the mandibular molar tooth germ at the bud stage"
        ],
        "length": 312,
        "sequence": "MGSKALPAPIPLHPSLQLTNYSFLQAVNTFPAAVDHLQGLYGLSAVQTMHMNHWTLGYPNVHEITRSTITEMAAAQGLMDARFPFQALPFTTHLFHPKQGAIAHVLPALHKDRPRFDFANLAVAATQEDPPKMGELTKLSSGLGSPISGLSKLTPDRKPSRGRLPSKTKKEFICKFCGRHFTKSYNLLIHERTHTDERPYTCDICHKAFRRQDHLRDHRYIHSKEKPFKCQECGKGFCQSRTLAVHKTLHMQESPHKCPTCGRTFNQRSNLKTHLLTHTDIKPYSCEQCGKVFRRNCDLRRHSLTHTPRQDF",
        "proteome": "UP000550707",
        "gene": "HJG59_013675",
        "go_terms": null,
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "3e9c744b29d0a970e8c812fb32e4ee435231c20a",
        "counters": {
            "domain_architectures": 21678,
            "entries": 10,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "pfam": 1,
                "smart": 1,
                "profile": 1,
                "panther": 1,
                "prosite": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 21678
        }
    }
}