GET /api/protein/UniProt/A0A7J8CFS9/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A7J8CFS9",
        "id": "A0A7J8CFS9_ROUAE",
        "source_organism": {
            "taxId": "9407",
            "scientificName": "Rousettus aegyptiacus",
            "fullName": "Rousettus aegyptiacus (Egyptian fruit bat)"
        },
        "name": "Electron transfer flavoprotein subunit alpha",
        "description": [
            "Heterodimeric electron transfer flavoprotein that accepts electrons from several mitochondrial dehydrogenases, including acyl-CoA dehydrogenases, glutaryl-CoA and sarcosine dehydrogenase. It transfers the electrons to the main mitochondrial respiratory chain via ETF-ubiquinone oxidoreductase (ETF dehydrogenase). Required for normal mitochondrial fatty acid oxidation and normal amino acid metabolism",
            "The electron transfer flavoprotein serves as a specific electron acceptor for several dehydrogenases, including five acyl-CoA dehydrogenases, glutaryl-CoA and sarcosine dehydrogenase. It transfers the electrons to the main mitochondrial respiratory chain via ETF-ubiquinone oxidoreductase (ETF dehydrogenase)"
        ],
        "length": 311,
        "sequence": "MLRAAAPKRVQRAASWLRFQSTLVIAEHGNDTLAPITLNAITAAKRLGGEVSCLIAGTKCDKVAQDLCKVAGVAKVLVAQHDAYKGLLPEELTPLILATQKQFNYTHICAGASAFGKNLLPRIAAKLDVAPVSDIIAVKSPDTFVRTIYAGNAVCTVKCDEKVKVFSVRGTSFEAAATSGGSASSEKASSTSLVGLSEWLEQKLTKSDRPELTGAKVVVSGGRGLKSGENFKLLYDLADQLHAAVGASRAAVDAGFVPNDMQVGQTGKIVAPELYIAVGISGAIQHLAGMKDSKSYPHVSERPSSWLITEV",
        "proteome": "UP000593571",
        "gene": "HJG63_004648",
        "go_terms": [
            {
                "identifier": "GO:0009055",
                "name": "electron transfer activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0050660",
                "name": "flavin adenine dinucleotide binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "40422e0a1e864f427b9ada5b552568aa56fecfcf",
        "counters": {
            "domain_architectures": 32728,
            "entries": 16,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 3,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 2,
                "cdd": 1,
                "ssf": 2,
                "pfam": 2,
                "smart": 1,
                "panther": 1,
                "pirsf": 1,
                "interpro": 6
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 32728
        }
    }
}