GET /api/protein/UniProt/A0A7J8AGW0/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A7J8AGW0",
        "id": "A0A7J8AGW0_MYOMY",
        "source_organism": {
            "taxId": "51298",
            "scientificName": "Myotis myotis",
            "fullName": "Myotis myotis (Greater mouse-eared bat)"
        },
        "name": "(Lyso)-N-acylphosphatidylethanolamine lipase",
        "description": [
            "Lysophospholipase selective for N-acyl phosphatidylethanolamine (NAPE). Contributes to the biosynthesis of N-acyl ethanolamines, including the endocannabinoid anandamide by hydrolyzing the sn-1 and sn-2 acyl chains from N-acyl phosphatidylethanolamine (NAPE) generating glycerophospho-N-acyl ethanolamine (GP-NAE), an intermediate for N-acyl ethanolamine biosynthesis. Hydrolyzes substrates bearing saturated, monounsaturated, polyunsaturated N-acyl chains. Shows no significant activity towards other lysophospholipids, including lysophosphatidylcholine, lysophosphatidylethanolamine and lysophosphatidylserine"
        ],
        "length": 318,
        "sequence": "MSQLKNVEAKILQCLQNKFLARYVSLPNQNKIWTVTVSPELRDRTPLVMVHGFGGGVGLWILNMDSLSARRTLHTFDLLGFGRSSRPTFPRDPEGAENEFVISIETWRETMGIPSMILLGHSLGGFLATSYSIKYPERVKHLILVDPWGFPLRPTDPSEIRAPPTWVKAVASVLGRSNPLAVLRIAGPWGPGLVQRFRPDFKRKFADFFEDDTISEYIYHCNAQNPSGETAFKAMMESFGWARRPMIERIHLIRKDVPITMIYGSNTWIDTSTGKKVKLQRPDSYVRDMEIEGASHHVYADQPHIFNAVVEEICDSVD",
        "proteome": "UP000527355",
        "gene": "mMyoMyo1_000092",
        "go_terms": null,
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "4208e7859dea7ff67287230d6f84ba11d78c698d",
        "counters": {
            "domain_architectures": 386493,
            "entries": 7,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "cathgene3d": 1,
                "pfam": 1,
                "panther": 1,
                "prints": 1,
                "interpro": 2
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 386493
        }
    }
}