GET /api/protein/UniProt/A0A7J8AGW0/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A7J8AGW0",
"id": "A0A7J8AGW0_MYOMY",
"source_organism": {
"taxId": "51298",
"scientificName": "Myotis myotis",
"fullName": "Myotis myotis (Greater mouse-eared bat)"
},
"name": "(Lyso)-N-acylphosphatidylethanolamine lipase",
"description": [
"Lysophospholipase selective for N-acyl phosphatidylethanolamine (NAPE). Contributes to the biosynthesis of N-acyl ethanolamines, including the endocannabinoid anandamide by hydrolyzing the sn-1 and sn-2 acyl chains from N-acyl phosphatidylethanolamine (NAPE) generating glycerophospho-N-acyl ethanolamine (GP-NAE), an intermediate for N-acyl ethanolamine biosynthesis. Hydrolyzes substrates bearing saturated, monounsaturated, polyunsaturated N-acyl chains. Shows no significant activity towards other lysophospholipids, including lysophosphatidylcholine, lysophosphatidylethanolamine and lysophosphatidylserine"
],
"length": 318,
"sequence": "MSQLKNVEAKILQCLQNKFLARYVSLPNQNKIWTVTVSPELRDRTPLVMVHGFGGGVGLWILNMDSLSARRTLHTFDLLGFGRSSRPTFPRDPEGAENEFVISIETWRETMGIPSMILLGHSLGGFLATSYSIKYPERVKHLILVDPWGFPLRPTDPSEIRAPPTWVKAVASVLGRSNPLAVLRIAGPWGPGLVQRFRPDFKRKFADFFEDDTISEYIYHCNAQNPSGETAFKAMMESFGWARRPMIERIHLIRKDVPITMIYGSNTWIDTSTGKKVKLQRPDSYVRDMEIEGASHHVYADQPHIFNAVVEEICDSVD",
"proteome": "UP000527355",
"gene": "mMyoMyo1_000092",
"go_terms": null,
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "4208e7859dea7ff67287230d6f84ba11d78c698d",
"counters": {
"domain_architectures": 386493,
"entries": 7,
"isoforms": 0,
"proteomes": 1,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 1,
"cathgene3d": 1,
"pfam": 1,
"panther": 1,
"prints": 1,
"interpro": 2
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 386493
}
}
}