General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A7J7ZM93",
        "id": "A0A7J7ZM93_PIPKU",
        "source_organism": {
            "taxId": "59472",
            "scientificName": "Pipistrellus kuhlii",
            "fullName": "Pipistrellus kuhlii (Kuhl's pipistrelle)"
        },
        "name": "Protein phosphatase 1 regulatory subunit 1A",
        "description": [
            "Inhibitor of protein-phosphatase 1. This protein may be important in hormonal control of glycogen metabolism. Hormones that elevate intracellular cAMP increase I-1 activity in many tissues. I-1 activation may impose cAMP control over proteins that are not directly phosphorylated by PKA. Following a rise in intracellular calcium, I-1 is inactivated by calcineurin (or PP2B). Does not inhibit type-2 phosphatases"
        ],
        "length": 172,
        "sequence": "MEPDNSPRRIQFTVPLLEPHLDPEAAEQIRRRRPTPATLVLTSDQSSPEIDEDRIPNPLLKSTLSMSPRQRKKVTRTTPTMKELQMMVEHHLGQQQQGEEPEGAAESTGTQETCPPETADTPAGSRLGASGEAQKLAESTPNTQERGSEKPSTDELSTHIPPPGSQGANSQV",
        "proteome": "UP000558488",
        "gene": "mPipKuh1_013962",
        "go_terms": [
            {
                "identifier": "GO:0004864",
                "name": "protein phosphatase inhibitor activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0007165",
                "name": "signal transduction",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "19ee467d71e9dbb53dc1e7ad74e03705adfe9608",
        "counters": {
            "domain_architectures": 2508,
            "entries": 3,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "panther": 1,
                "pfam": 1,
                "interpro": 1
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 2508
        }
    }
}