GET /api/protein/UniProt/A0A7J7YVM6/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A7J7YVM6",
"id": "A0A7J7YVM6_PIPKU",
"source_organism": {
"taxId": "59472",
"scientificName": "Pipistrellus kuhlii",
"fullName": "Pipistrellus kuhlii (Kuhl's pipistrelle)"
},
"name": "sn-1-specific diacylglycerol lipase ABHD11",
"description": [
"Catalyzes the hydrolysis of diacylglycerol in vitro and may function as a key regulator in lipid metabolism, namely by regulating the intracellular levels of diacylglycerol. 1,2-diacyl-sn-glycerols are the preferred substrate over 1,3-diacyl-sn-glycerols. The enzyme hydrolyzes stearate in preference to palmitate from the sn-1 position of 1,2-diacyl-sn-glycerols. Maintains the functional lipoylation of the 2-oxoglutarate dehydrogenase complex (OGDHc) through its interaction with the OGDHc by preventing the formation of lipoyl adducts. In addition, is also required for the expansion and differentiation of embryonic stem cells (ESCs)"
],
"length": 263,
"sequence": "MLSWARTWRLLPGGLELPRICFSRVPVAPSSSSGRSGAKPRRSVPLSYKLLDGEAGRPALVFLHGLFGSKTNFNSIAKALAQQTGRRVLTVDARNHGDSPHSPDMSYEAMIQDLQDLLPQLGLAPCVLIGHSMGGKTAMLLALQRPELVERLVAVDISPVNTITSSNFPAYVAAMKAIDIPEKMSRSSARRLADKKLSSLIQDTAVREFLLTNLVEADGRFVWRVNLDALAQHVDEILAFPPQQESYPGPTLFLLGGKSDFVQ",
"proteome": "UP000558488",
"gene": "mPipKuh1_000073",
"go_terms": null,
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "4208e7859dea7ff67287230d6f84ba11d78c698d",
"counters": {
"domain_architectures": 386493,
"entries": 7,
"isoforms": 0,
"proteomes": 1,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 1,
"cathgene3d": 1,
"pfam": 1,
"panther": 1,
"prints": 1,
"interpro": 2
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 386493
}
}
}