General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A7J7YKM9",
        "id": "A0A7J7YKM9_RHIFE",
        "source_organism": {
            "taxId": "59479",
            "scientificName": "Rhinolophus ferrumequinum",
            "fullName": "Rhinolophus ferrumequinum (Greater horseshoe bat)"
        },
        "name": "RING-type E3 ubiquitin transferase",
        "description": [
            "E3 ubiquitin-protein ligase involved in the regulation of Fas-, DR3- and DR4-mediated apoptosis. Functions in conjunction with the UBE2D1, UBE2D3 and UBE2E1 E2 ubiquitin-conjugating enzymes"
        ],
        "length": 636,
        "sequence": "MLRQGCKTSERRRHVSDRLSCQQDQALSSSIYLLREMGPTGFLLREEEPENRDFRVFLGNPHVCNCSTSQKGGELCKHICWVLLKKFKLPRNHESALQLGLVEGEISDLLRGIHRVQTPQKGTNDENTHIEADGYIKQKEIGSDDICSICQEVLLEKKLPVTFCRFGCGNNVHIKCMKILANYQDKVSNTSMLKCPLCRKEFAPLKLILEEFKNSSKFVAAAEKQRLDKHLGIPCNNCKQFPIEGKCYKCTQCIEYHLCQECFDNCCHLSHPFTFREKRNQRWKALEKRSDEIVKYIDTKNDMEEKMPHFQEKQGQVYTPKRVVKSLPLLLITKSSKLLAPGYQCRLCLKAFHLGQFTRLLPCTHKFHRKCIDSWLFHKCNSCPIDGQVIYNPLIWKDTAMNGHVHHSVSNTDTSHLSKQEEQGLFIPGIGLVLKQTRLGILPSIPQHNSEKLNTPQSSIDTYQNKAIDDLYSIKSDDSNSRKLIYEHKTSQHFPKYLQGLPTESFGKISSQTFLPSIAHKNMICPSGLASPSINKKYHTSQSQKMTKDCIHINHNPKKNLDTKIREENRRTNTLPPEDLHLIVNWGTSKLSLSKRYNNSFGKIRPKYSHLSRRPRSHDLNTRSTELSLILQGIQL",
        "proteome": null,
        "gene": "mRhiFer1_019049",
        "go_terms": [
            {
                "identifier": "GO:0008270",
                "name": "zinc ion binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0061630",
                "name": "ubiquitin protein ligase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 4,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "27fad6b23b26473ff00d1c6950739e2658a484e2",
        "counters": {
            "domain_architectures": 230,
            "entries": 21,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 3,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "pfam": 3,
                "profile": 3,
                "cathgene3d": 2,
                "ssf": 1,
                "cdd": 3,
                "smart": 1,
                "panther": 1,
                "prosite": 1,
                "interpro": 6
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 230
        }
    }
}