GET /api/protein/UniProt/A0A7J7WY89/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A7J7WY89",
        "id": "A0A7J7WY89_MYOMY",
        "source_organism": {
            "taxId": "51298",
            "scientificName": "Myotis myotis",
            "fullName": "Myotis myotis (Greater mouse-eared bat)"
        },
        "name": "Triadin",
        "description": [
            "Contributes to the regulation of lumenal Ca2+ release via the sarcoplasmic reticulum calcium release channels RYR1 and RYR2, a key step in triggering skeletal and heart muscle contraction. Required for normal organization of the triad junction, where T-tubules and the sarcoplasmic reticulum terminal cisternae are in close contact. Required for normal skeletal muscle strength. Plays a role in excitation-contraction coupling in the heart and in regulating the rate of heart beats"
        ],
        "length": 281,
        "sequence": "MTEITAEGNASTTTTVIDSKNGSVPKSPGKVLKRTVTEDIVTTFSSPAAWLLVIALIVTWSAVAVVMFDLVDYKNFSASSISKIGSDPVKFVHHAVEETTDWVYGFFSLLSDIISSEGDEEEEEDGDEDTDTGEIEEPPLKKKEIRKEKTEKEEKPERKLQTKVTHREKDKVKEKEKPEKKATHKEKVEKKEKQETKTMAKEEKKTKTKEKTEVKTKKEPKGGKQEKVKQSAAKGKEVQKTSPKPKGKDEKETVAVSKHEQKECILSQLPLRRELDKAAAE",
        "proteome": "UP000527355",
        "gene": "mMyoMyo1_019704",
        "go_terms": [
            {
                "identifier": "GO:0005102",
                "name": "signaling receptor binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0016020",
                "name": "membrane",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            },
            {
                "identifier": "GO:0016529",
                "name": "sarcoplasmic reticulum",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 4,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "af6f1641e7a9309ba58401a49c3075e7ce16089a",
        "counters": {
            "domain_architectures": 3012,
            "entries": 4,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "panther": 1,
                "pfam": 1,
                "interpro": 2
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 3012
        }
    }
}