GET /api/protein/UniProt/A0A7J7WY89/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A7J7WY89",
"id": "A0A7J7WY89_MYOMY",
"source_organism": {
"taxId": "51298",
"scientificName": "Myotis myotis",
"fullName": "Myotis myotis (Greater mouse-eared bat)"
},
"name": "Triadin",
"description": [
"Contributes to the regulation of lumenal Ca2+ release via the sarcoplasmic reticulum calcium release channels RYR1 and RYR2, a key step in triggering skeletal and heart muscle contraction. Required for normal organization of the triad junction, where T-tubules and the sarcoplasmic reticulum terminal cisternae are in close contact. Required for normal skeletal muscle strength. Plays a role in excitation-contraction coupling in the heart and in regulating the rate of heart beats"
],
"length": 281,
"sequence": "MTEITAEGNASTTTTVIDSKNGSVPKSPGKVLKRTVTEDIVTTFSSPAAWLLVIALIVTWSAVAVVMFDLVDYKNFSASSISKIGSDPVKFVHHAVEETTDWVYGFFSLLSDIISSEGDEEEEEDGDEDTDTGEIEEPPLKKKEIRKEKTEKEEKPERKLQTKVTHREKDKVKEKEKPEKKATHKEKVEKKEKQETKTMAKEEKKTKTKEKTEVKTKKEPKGGKQEKVKQSAAKGKEVQKTSPKPKGKDEKETVAVSKHEQKECILSQLPLRRELDKAAAE",
"proteome": "UP000527355",
"gene": "mMyoMyo1_019704",
"go_terms": [
{
"identifier": "GO:0005102",
"name": "signaling receptor binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0016020",
"name": "membrane",
"category": {
"code": "C",
"name": "cellular_component"
}
},
{
"identifier": "GO:0016529",
"name": "sarcoplasmic reticulum",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 4,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "af6f1641e7a9309ba58401a49c3075e7ce16089a",
"counters": {
"domain_architectures": 3012,
"entries": 4,
"isoforms": 0,
"proteomes": 1,
"sets": 0,
"structures": 0,
"taxa": 1,
"dbEntries": {
"panther": 1,
"pfam": 1,
"interpro": 2
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 3012
}
}
}