GET /api/protein/UniProt/A0A7J7VHN9/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A7J7VHN9",
        "id": "A0A7J7VHN9_MYOMY",
        "source_organism": {
            "taxId": "51298",
            "scientificName": "Myotis myotis",
            "fullName": "Myotis myotis (Greater mouse-eared bat)"
        },
        "name": "BZIP domain-containing protein",
        "description": null,
        "length": 268,
        "sequence": "MFRDFGEPGPSSGPGGAYGGPAQPPATGQQKFHLVPSINAVSGSQELQWMVQPHFLGPSSYPRPLAYPQYSYPQPRPGVIRALGPPPGVRRRPSEQISPEEEERRRVRRERNKLAAAKCRNRRKELTDFLQAETDKLEDEKSGLQREIEELQKQKERLELVLEAHRPICKIPEGAKESATGGPGGASSPAAPSRPVPCISLSPGPVLEPEALHTPTLMTTPSLTPFTPSLVFTYPSTPEPCASAHRRSSSSSGDPSSDPLGSPTLLAL",
        "proteome": "UP000527355",
        "gene": "mMyoMyo1_005262",
        "go_terms": [
            {
                "identifier": "GO:0003700",
                "name": "DNA-binding transcription factor activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006355",
                "name": "regulation of DNA-templated transcription",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0003677",
                "name": "DNA binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006357",
                "name": "regulation of transcription by RNA polymerase II",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 4,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "890c9e17a3b426c841f953529dd29b6d471f4ea1",
        "counters": {
            "domain_architectures": 65153,
            "entries": 12,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "smart": 1,
                "profile": 1,
                "ssf": 1,
                "cdd": 1,
                "panther": 1,
                "prosite": 1,
                "prints": 1,
                "pfam": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 65153
        }
    }
}