General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A7J7V5D0",
        "id": "A0A7J7V5D0_MYOMY",
        "source_organism": {
            "taxId": "51298",
            "scientificName": "Myotis myotis",
            "fullName": "Myotis myotis (Greater mouse-eared bat)"
        },
        "name": "Succinyl-CoA:glutarate CoA-transferase",
        "description": [
            "Coenzyme A (CoA) transferase that reversibly catalyzes the transfer of a CoA moiety from a dicarboxyl-CoA to a dicarboxylate in a metabolite recycling process. Displays preference for succinyl-CoA and glutarate-CoA as dicarboxyl-CoA donors and glutarate, succinate, adipate/hexanedioate, itaconate and 3-hydroxy-3-methylglutarate as dicarboxylate acceptors. Acts on intermediates or end products of lysine and tryptophan degradation pathway, in particular catalyzes succinyl-CoA-dependent reesterification of free glutarate into glutaryl-CoA to prevent renal excretion of glutarate. Upon inflammation, may convert macrophage-derived itaconate to itaconyl-CoA in erythroid precursors where it negatively regulates the TCA cycle and heme synthesis to limit erythroid differentiation in the context of stress erythropoiesis"
        ],
        "length": 383,
        "sequence": "MLAALARVAALRRTGCVRGPGGRRQLWTGPPQSDTDNVKPLEGIKVLDLTRVLAGPFATMNLGDLGAEVIKVERPGAGDDTRTWGPPFVGTESTYFLSVNRNKKSIAVNIKDPKGVKIIKELAAVCDVFVENYVPGKLSAMGLGYEEIDRIAPHIVYCSITGYGQTGPLSQRAGYDAVASAVSGLMHITGPEDGDPVRPGVAMTDLATGLYAYGAIMAGLIQRYKTGKGLFIDCNLLSSQVACLTQVAANYLIGQKEAKRWGTAHGSIVPYQAFKTKDGYLVVGAGNNQQFATVCKILNLPELIDDCKYKTNHLRVQNRKELIKILSARFEEEMTSKWLHLFEGSKVPYGPINNMKNVFAEPQGHETLSSMKPELLLIFLHAS",
        "proteome": "UP000527355",
        "gene": "mMyoMyo1_018569",
        "go_terms": [
            {
                "identifier": "GO:0003824",
                "name": "catalytic activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "e15f2aec4310ca0156719fd0f208596489f1c4ae",
        "counters": {
            "domain_architectures": 85455,
            "entries": 9,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "cathgene3d": 2,
                "panther": 1,
                "pfam": 1,
                "interpro": 4
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 85455
        }
    }
}