GET /api/protein/UniProt/A0A7J7UM22/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A7J7UM22",
"id": "A0A7J7UM22_PIPKU",
"source_organism": {
"taxId": "59472",
"scientificName": "Pipistrellus kuhlii",
"fullName": "Pipistrellus kuhlii (Kuhl's pipistrelle)"
},
"name": "Membrane magnesium transporter",
"description": [
"Part of the endoplasmic reticulum membrane protein complex (EMC) that enables the energy-independent insertion into endoplasmic reticulum membranes of newly synthesized membrane proteins. May be involved in Mg(2+) transport"
],
"length": 132,
"sequence": "MALSLWKGLVGIGLFALAHSAFSAAQHRSYMRLMEKEDESLPIDIVLQTLLAFAVTCYGIVHIAGEFKDMDATSELKNKAFDTLRNHPSFYVFNHRGRVLFQPSNITNSSSQDALLSSNTSLKLRKLESLRR",
"proteome": "UP000558488",
"gene": "mPipKuh1_011614",
"go_terms": null,
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "9e6ba804fc9271b98ec61997447775d85d4f123c",
"counters": {
"domain_architectures": 2983,
"entries": 3,
"isoforms": 0,
"proteomes": 1,
"sets": 0,
"structures": 0,
"taxa": 1,
"dbEntries": {
"panther": 1,
"pfam": 1,
"interpro": 1
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 2983
}
}
}