HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A7J7STJ8",
"id": "A0A7J7STJ8_MYOMY",
"source_organism": {
"taxId": "51298",
"scientificName": "Myotis myotis",
"fullName": "Myotis myotis (Greater mouse-eared bat)"
},
"name": "Ammonium transporter Rh type B",
"description": [
"Ammonium transporter involved in the maintenance of acid-base homeostasis. Transports ammonium and its related derivative methylammonium across the basolateral plasma membrane of epithelial cells likely contributing to renal transepithelial ammonia transport and ammonia metabolism. May transport either NH4(+) or NH3 ammonia species predominantly mediating an electrogenic NH4(+) transport. May act as a CO2 channel providing for renal acid secretion"
],
"length": 458,
"sequence": "MAPTPRRAARRRLQLPLLCLLLQGATAILFAVFVRYNHETDAALWHGGNHSNADNEFYFRYPSFQDVHTMVFVGFGFLMAFLQRYGFSSIGFTFLLAAFALQWSTLVQGFLHSFHGSHIHVGVESMINADFCAGAVLISFGAVLGKTGPAQLLLMALLEVALFGINEFVLLTLLGVKDAGGSMTIHTFGAYFGLVLSRVLYRPQLEKSKHRQGSVYHSDLFAMIGTIFLWIFWPSFNSAPTTLGDGQHRTALNTYYSLTASTLSTFALSALVGKDGRLDMVHIQNAALAGGVVVGTASEMMLTPFGALAAGFLAGTVSTLGYKFFTPVLESKFKVQDTCGVHNLHGMPGVLGALLGVLVAGLATHDAYGDGLQSVFPLMAEGRRSATAQAMYQLFGLFVTLTVASVGGSVGGCLLKLPFLDAPPDSQCYEDQIYWEVPGEHEDEAQGPLRAEELDTQA",
"proteome": "UP000527355",
"gene": "mMyoMyo1_016548",
"go_terms": [
{
"identifier": "GO:0008519",
"name": "ammonium channel activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0072488",
"name": "ammonium transmembrane transport",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0016020",
"name": "membrane",
"category": {
"code": "C",
"name": "cellular_component"
}
},
{
"identifier": "GO:0005886",
"name": "plasma membrane",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "14427add94f7c674d338d0744985654311a31e6a",
"counters": {
"domain_architectures": 54022,
"entries": 8,
"isoforms": 0,
"proteomes": 1,
"sets": 0,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"panther": 1,
"pfam": 1,
"prints": 1,
"interpro": 3
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 54022
}
}
}