General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A7J7SEJ9",
        "id": "A0A7J7SEJ9_PIPKU",
        "source_organism": {
            "taxId": "59472",
            "scientificName": "Pipistrellus kuhlii",
            "fullName": "Pipistrellus kuhlii (Kuhl's pipistrelle)"
        },
        "name": "Ethanolamine-phosphate cytidylyltransferase",
        "description": [
            "Ethanolamine-phosphate cytidylyltransferase that catalyzes the second step in the synthesis of phosphatidylethanolamine (PE) from ethanolamine via the CDP-ethanolamine pathway. Phosphatidylethanolamine is a dominant inner-leaflet phospholipid in cell membranes, where it plays a role in membrane function by structurally stabilizing membrane-anchored proteins, and participates in important cellular processes such as cell division, cell fusion, blood coagulation, and apoptosis"
        ],
        "length": 389,
        "sequence": "MIRNGHGLAGGAEPPGPGARAAVRVWCDGCYDMVHYGHSNQLRQARAMGDYLIVGVHTDEEISKHKGPPVFTQEERYKMVKAIKWVDEVVPAAPYVTTLETLDKFRCDFCVHGNDITLTVDGRDTYEEVKQAGRYRECKRTQGVSTTDLVGRMLLMTKAHHSGQEMSSEYRAYADSFGKCPGGRNPWTGVSQFLQTSRKIIQFASGKEPQPGETIIYVAGAFDLFHIGHVDFLAKAHGLAERPYVIAGLHFDQEVNHYKGKNYPIMNLHERTLSVLACRYVSEVVIGAPYAVTAELLDHFKVDLVCHGKTEIVPDKDGSDPYQEPKKRGIFRQIDSGSNLTTDLIVQRIIKNRLEYEARNQKKEAKELAFLEAVKQQEELPERGSHVAF",
        "proteome": "UP000558488",
        "gene": "mPipKuh1_013239",
        "go_terms": [
            {
                "identifier": "GO:0003824",
                "name": "catalytic activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0009058",
                "name": "biosynthetic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0004306",
                "name": "ethanolamine-phosphate cytidylyltransferase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006646",
                "name": "phosphatidylethanolamine biosynthetic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "89a52e9e96b249891a326bcc8f5732ef89c0f2f2",
        "counters": {
            "domain_architectures": 4905,
            "entries": 11,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "cdd": 2,
                "ncbifam": 1,
                "ssf": 1,
                "pfam": 1,
                "panther": 1,
                "interpro": 4
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 4905
        }
    }
}