GET /api/protein/UniProt/A0A7J7SAS4/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A7J7SAS4",
"id": "A0A7J7SAS4_MYOMY",
"source_organism": {
"taxId": "51298",
"scientificName": "Myotis myotis",
"fullName": "Myotis myotis (Greater mouse-eared bat)"
},
"name": "Calpain small subunit 1",
"description": [
"Regulatory subunit of the calcium-regulated non-lysosomal thiol-protease which catalyzes limited proteolysis of substrates involved in cytoskeletal remodeling and signal transduction. Essential for embryonic development"
],
"length": 226,
"sequence": "MFLVNSFLKGGGGGTAMRILGGVISAISEAAAQYNPEPPPPRTHYSNIEANESEEVRQFRRLFAQLAGDDMEVSATELMNILNKVVTRHPDLKTDGFGIDTCRSMVAVMDSDTTGKLGFEEFKYLWNNIKKWQAIYKQFDVDHSGTIGSSELPGAFEAAGFHLNEHLYNMIIRRYSDEEGNMDFDNFISCLVRLDAMFRAFKSLDKDGTGQIQVNIQEWLQLTMYS",
"proteome": "UP000527355",
"gene": "mMyoMyo1_002065",
"go_terms": [
{
"identifier": "GO:0005509",
"name": "calcium ion binding",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 4,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": null,
"counters": {
"domain_architectures": 0,
"entries": 9,
"isoforms": 0,
"proteomes": 1,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 1,
"cathgene3d": 1,
"cdd": 1,
"profile": 1,
"panther": 1,
"prosite": 1,
"interpro": 3
},
"proteome": 1,
"taxonomy": 1
}
}
}