GET /api/protein/UniProt/A0A7J7R432/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A7J7R432",
"id": "A0A7J7R432_MYOMY",
"source_organism": {
"taxId": "51298",
"scientificName": "Myotis myotis",
"fullName": "Myotis myotis (Greater mouse-eared bat)"
},
"name": "Vacuolar protein sorting-associated protein 28 homolog",
"description": [
"Component of the ESCRT-I complex (endosomal sorting complex required for transport I), a regulator of vesicular trafficking process"
],
"length": 224,
"sequence": "MPESGRSESSAQVAPQHTPSGPCSYPEQPSHPGSEGRGYDNMAELFAVVKTMQALEKAYIKDCVTPNEYTAACSRLLVQYKAAFRQVQGSEISSIDEFCRKFRLDCPLAMERIKEDRPITIKDDKGNLNRCIADVVSLFITVMDKLRLEIRAMDEIQPDLRELMETMHRMSHLPPDFEGRQTVSQWLQTLSGMSASDELDDNQVRQMLFDLESAYNAFNRFLHA",
"proteome": "UP000527355",
"gene": "mMyoMyo1_020390",
"go_terms": [
{
"identifier": "GO:0032509",
"name": "endosome transport via multivesicular body sorting pathway",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0000813",
"name": "ESCRT I complex",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "41460f13397e6c0976fa16b5c415c867a33c4e89",
"counters": {
"domain_architectures": 4089,
"entries": 15,
"isoforms": 0,
"proteomes": 1,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 2,
"ssf": 2,
"profile": 2,
"panther": 1,
"pirsf": 1,
"pfam": 1,
"interpro": 6
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 4089
}
}
}