GET /api/protein/UniProt/A0A7J7QXN9/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A7J7QXN9",
"id": "A0A7J7QXN9_RHIFE",
"source_organism": {
"taxId": "59479",
"scientificName": "Rhinolophus ferrumequinum",
"fullName": "Rhinolophus ferrumequinum (Greater horseshoe bat)"
},
"name": "Thioredoxin-like protein",
"description": [
"Plays a role in pre-mRNA splicing as component of the U5 snRNP and U4/U6-U5 tri-snRNP complexes that are involved in spliceosome assembly, and as component of the precatalytic spliceosome (spliceosome B complex)",
"Plays role in pre-mRNA splicing"
],
"length": 142,
"sequence": "MSYMLPHLHNGWQVDQAILSEEDRVVVIRFGHDWDPTCMKMDEVLYSIAEKVKNFAVIYLVDITEVPDFNKMYELYDPCTVMFFFRNKHIMIDLGTGNNNKINWAMEDKQEMIDIIETVYRGARKGRGLVVSPKDYSTKYRY",
"proteome": null,
"gene": "mRhiFer1_017842",
"go_terms": [
{
"identifier": "GO:0000398",
"name": "mRNA splicing, via spliceosome",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0046540",
"name": "U4/U6 x U5 tri-snRNP complex",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "59aa23f52382d23a621be8cad4dabfc2ec0a1ac6",
"counters": {
"domain_architectures": 6453,
"entries": 9,
"isoforms": 0,
"proteomes": 0,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"smart": 1,
"pfam": 1,
"cdd": 1,
"panther": 1,
"pirsf": 1,
"interpro": 2
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 6453
}
}
}