GET /api/protein/UniProt/A0A7J7E7P5/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A7J7E7P5",
        "id": "A0A7J7E7P5_DICBM",
        "source_organism": {
            "taxId": "77932",
            "scientificName": "Diceros bicornis minor",
            "fullName": "Diceros bicornis minor (South-central black rhinoceros)"
        },
        "name": "Aspartoacylase",
        "description": [
            "Catalyzes the deacetylation of N-acetylaspartic acid (NAA) to produce acetate and L-aspartate. NAA occurs in high concentration in brain and its hydrolysis NAA plays a significant part in the maintenance of intact white matter. In other tissues it acts as a scavenger of NAA from body fluids"
        ],
        "length": 368,
        "sequence": "MKEHLMGHFFLTTATFPPPPPQLKYECLSLRTTAIVVNEQPLPLLLRNQIKLLDKMTSCHVTEDPIKKVAIFGGTHGNELTGIFLVKHWLENGAEIQRTGLEVKPFITNPRAVKKCTRYIDCDLNRVFDLENLGKKMSEDLPYEVRRAQEINHLFGPKDSEDSYDIIFDLHNTTSNMGCTLILEDSRNDFLIQMFHYIKTSLAPLPCYVYLIEHPSLKYATTRSVAKYPVGIEVGPQPQGVLRADILDQMRKMIKHALDFICNFNEGKEFPPCTIEVYNIMEKVDYPRNESGEIAAIIHPTLQDHDWKPLHPGDPVFLTLDGETIPLGGDCTVYPVFVNEAAYYEKKEAFAKTTKLTLNAKSIRSSLH",
        "proteome": "UP000551758",
        "gene": "HPG69_015699",
        "go_terms": [
            {
                "identifier": "GO:0016788",
                "name": "hydrolase activity, acting on ester bonds",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0016811",
                "name": "hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in linear amides",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "b4d280380897cbd59ff40da1da8545ff27d11c17",
        "counters": {
            "domain_architectures": 6274,
            "entries": 13,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 3,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "pfam": 2,
                "cdd": 1,
                "cathgene3d": 2,
                "panther": 1,
                "hamap": 1,
                "ncbifam": 1,
                "interpro": 4
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 6274
        }
    }
}