GET /api/protein/UniProt/A0A7J7E7P5/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A7J7E7P5",
"id": "A0A7J7E7P5_DICBM",
"source_organism": {
"taxId": "77932",
"scientificName": "Diceros bicornis minor",
"fullName": "Diceros bicornis minor (South-central black rhinoceros)"
},
"name": "Aspartoacylase",
"description": [
"Catalyzes the deacetylation of N-acetylaspartic acid (NAA) to produce acetate and L-aspartate. NAA occurs in high concentration in brain and its hydrolysis NAA plays a significant part in the maintenance of intact white matter. In other tissues it acts as a scavenger of NAA from body fluids"
],
"length": 368,
"sequence": "MKEHLMGHFFLTTATFPPPPPQLKYECLSLRTTAIVVNEQPLPLLLRNQIKLLDKMTSCHVTEDPIKKVAIFGGTHGNELTGIFLVKHWLENGAEIQRTGLEVKPFITNPRAVKKCTRYIDCDLNRVFDLENLGKKMSEDLPYEVRRAQEINHLFGPKDSEDSYDIIFDLHNTTSNMGCTLILEDSRNDFLIQMFHYIKTSLAPLPCYVYLIEHPSLKYATTRSVAKYPVGIEVGPQPQGVLRADILDQMRKMIKHALDFICNFNEGKEFPPCTIEVYNIMEKVDYPRNESGEIAAIIHPTLQDHDWKPLHPGDPVFLTLDGETIPLGGDCTVYPVFVNEAAYYEKKEAFAKTTKLTLNAKSIRSSLH",
"proteome": "UP000551758",
"gene": "HPG69_015699",
"go_terms": [
{
"identifier": "GO:0016788",
"name": "hydrolase activity, acting on ester bonds",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0016811",
"name": "hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in linear amides",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "b4d280380897cbd59ff40da1da8545ff27d11c17",
"counters": {
"domain_architectures": 6274,
"entries": 13,
"isoforms": 0,
"proteomes": 1,
"sets": 3,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 1,
"pfam": 2,
"cdd": 1,
"cathgene3d": 2,
"panther": 1,
"hamap": 1,
"ncbifam": 1,
"interpro": 4
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 6274
}
}
}