HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A7J6C7I2",
"id": "A0A7J6C7I2_9TELE",
"source_organism": {
"taxId": "369639",
"scientificName": "Onychostoma macrolepis",
"fullName": "Onychostoma macrolepis"
},
"name": "Apolipoprotein C-II",
"description": [
"Component of chylomicrons, very low-density lipoproteins (VLDL), low-density lipoproteins (LDL), and high-density lipoproteins (HDL) in plasma. Plays an important role in lipoprotein metabolism as an activator of lipoprotein lipase"
],
"length": 100,
"sequence": "MNKLLVITAVIAFLALGTESFRVPRQVEEEKGTISTVVDTIKSYYDQSVDTASGYVETIKGYKLNEKAKNLYEDTVRAVSTYAGIFNDQLYHILYPQESS",
"proteome": "UP000579812",
"gene": "G5714_016121",
"go_terms": [
{
"identifier": "GO:0008047",
"name": "enzyme activator activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006629",
"name": "lipid metabolic process",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0006869",
"name": "lipid transport",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0042627",
"name": "chylomicron",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "a0dc2cde25dff2dd7533878e0d5aaf581d56993c",
"counters": {
"domain_architectures": 415,
"entries": 5,
"isoforms": 0,
"proteomes": 1,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"panther": 1,
"pfam": 1,
"interpro": 2
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 415
}
}
}