GET /api/protein/UniProt/A0A7J6C7I2/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A7J6C7I2",
        "id": "A0A7J6C7I2_9TELE",
        "source_organism": {
            "taxId": "369639",
            "scientificName": "Onychostoma macrolepis",
            "fullName": "Onychostoma macrolepis"
        },
        "name": "Apolipoprotein C-II",
        "description": [
            "Component of chylomicrons, very low-density lipoproteins (VLDL), low-density lipoproteins (LDL), and high-density lipoproteins (HDL) in plasma. Plays an important role in lipoprotein metabolism as an activator of lipoprotein lipase"
        ],
        "length": 100,
        "sequence": "MNKLLVITAVIAFLALGTESFRVPRQVEEEKGTISTVVDTIKSYYDQSVDTASGYVETIKGYKLNEKAKNLYEDTVRAVSTYAGIFNDQLYHILYPQESS",
        "proteome": "UP000579812",
        "gene": "G5714_016121",
        "go_terms": [
            {
                "identifier": "GO:0008047",
                "name": "enzyme activator activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006629",
                "name": "lipid metabolic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0006869",
                "name": "lipid transport",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0042627",
                "name": "chylomicron",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "a0dc2cde25dff2dd7533878e0d5aaf581d56993c",
        "counters": {
            "domain_architectures": 415,
            "entries": 5,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "panther": 1,
                "pfam": 1,
                "interpro": 2
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 415
        }
    }
}