General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A7J6BJT7",
        "id": "A0A7J6BJT7_9TELE",
        "source_organism": {
            "taxId": "369639",
            "scientificName": "Onychostoma macrolepis",
            "fullName": "Onychostoma macrolepis"
        },
        "name": "Alpha-ketoglutarate-dependent dioxygenase alkB homolog 3",
        "description": [
            "Dioxygenase that mediates demethylation of DNA and RNA containing 1-methyladenosine (m1A). Repairs alkylated DNA containing 1-methyladenosine (m1A) and 3-methylcytosine (m3C) by oxidative demethylation. Has a strong preference for single-stranded DNA. Able to process alkylated m3C within double-stranded regions via its interaction with ASCC3, which promotes DNA unwinding to generate single-stranded substrate needed for ALKBH3. Can repair exocyclic 3,N4-ethenocytosine adducs in single-stranded DNA. Also acts on RNA. Demethylates N(1)-methyladenosine (m1A) RNA, an epigenetic internal modification of messenger RNAs (mRNAs) highly enriched within 5'-untranslated regions (UTRs) and in the vicinity of start codons. Requires molecular oxygen, alpha-ketoglutarate and iron"
        ],
        "length": 327,
        "sequence": "MSDKRQRARVQGSWAKPLHKPQQPTAQDVQSVSGSWKYGSRSFEFHQPADPIREIPTEKVFENAGDYEISQGPTGVSRLRLIPGFLQQEEADWMFSKLLAELPWSQKTNYRMMGDGYEEPRLTCWYGELPYTYSRSTMQANAQWHPVLTTLRLAVEEKSGHTFNSLLCNLYRDGKDSIGWHSDSEPSLGPQPLIASLSLGDTRVFSLRKQPLPEDKGDYTYVERIRIPLTHGTLLLMEGCTQTDWQHQVAKEYHDRGPRINLTFRTIYPEPEHPSGGDHWEKRRRDHRFDEIWRGLSHSQSTSDGYNVKHTSILFSLIIYLLVIVRF",
        "proteome": "UP000579812",
        "gene": "G5714_024264",
        "go_terms": [
            {
                "identifier": "GO:0051213",
                "name": "dioxygenase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006281",
                "name": "DNA repair",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0006307",
                "name": "DNA alkylation repair",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "908257cfaf43043a948bb4fa05b887e692b331c6",
        "counters": {
            "domain_architectures": 35525,
            "entries": 9,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "pfam": 1,
                "profile": 1,
                "panther": 1,
                "interpro": 4
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 35525
        }
    }
}