GET /api/protein/UniProt/A0A7I8BJB7/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A7I8BJB7",
"id": "A0A7I8BJB7_9BURK",
"source_organism": {
"taxId": "3014751",
"scientificName": "Paraburkholderia largidicola",
"fullName": "Paraburkholderia largidicola"
},
"name": "Alkyl hydroperoxide reductase AhpD",
"description": [
"Antioxidant protein with alkyl hydroperoxidase activity. Required for the reduction of the AhpC active site cysteine residues and for the regeneration of the AhpC enzyme activity"
],
"length": 174,
"sequence": "MEFIAAIKELIPDYAKDIRLNLDGTIARSSLQGTDAVGVALAAAFAAKSPKIIAAIREAGVLSPEEVNGALTAAALMGMNNVWYPYVEMTENADLKSQPAGLRMNAYASHGGVDKRRFEMYALAASIIGKCHFCVKSHFDTLVNEGMSSTQLRDVGRIAAVVNAAAQVIVAEGK",
"proteome": "UP000510888",
"gene": "ahpD",
"go_terms": [
{
"identifier": "GO:0032843",
"name": "hydroperoxide reductase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0051920",
"name": "peroxiredoxin activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006979",
"name": "response to oxidative stress",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "9188a95272c3942161dca27729a8bbdbe9bff9db",
"counters": {
"domain_architectures": 82038,
"entries": 10,
"isoforms": 0,
"proteomes": 1,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 1,
"cathgene3d": 1,
"ncbifam": 1,
"hamap": 1,
"panther": 1,
"pfam": 1,
"interpro": 4
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 82038
}
}
}