GET /api/protein/UniProt/A0A7H8QSR3/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A7H8QSR3",
        "id": "A0A7H8QSR3_TALRU",
        "source_organism": {
            "taxId": "121627",
            "scientificName": "Talaromyces rugulosus",
            "fullName": "Talaromyces rugulosus"
        },
        "name": "Eukaryotic translation initiation factor 2 subunit alpha",
        "description": [
            "eIF-2 functions in the early steps of protein synthesis by forming a ternary complex with GTP and initiator tRNA. This complex binds to a 40S ribosomal subunit, followed by mRNA binding to form a 43S pre-initiation complex. Junction of the 60S ribosomal subunit to form the 80S initiation complex is preceded by hydrolysis of the GTP bound to eIF-2 and release of an eIF-2-GDP binary complex. In order for eIF-2 to recycle and catalyze another round of initiation, the GDP bound to eIF-2 must exchange with GTP by way of a reaction catalyzed by eIF2B"
        ],
        "length": 308,
        "sequence": "MSLTNCRFYEEKYPEVDSFVMVNVKQIAEMGAYVKLLEYDNIDGMILLSELSRRRIRSIQKLIRIGRNEVVVVLRVDKEKGYIDLSKRRVSSEDVGKCEERYNKSKLVHSIMRHVAEKTKTPIEELYQNIGWPLNRNYGHSYDAFKLSITNPDVWNDVTFPNQLVKDELHTYIGKKLTPHPTKVRADVEVTCFGYDGIDAVKDALRAAEENNTPETQIKVKLVSPPLYVLTCQTLDKALGVKLLEEAIQNIEVKIKASNGTLTVKMAPKAVTAQDDVKLQELMDKRERENMEVSGDESQSESDEGVPE",
        "proteome": "UP000509510",
        "gene": "TRUGW13939_04090",
        "go_terms": [
            {
                "identifier": "GO:0003676",
                "name": "nucleic acid binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0003723",
                "name": "RNA binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0003743",
                "name": "translation initiation factor activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "2fb0ece446404da3daad65fe781defa909f63834",
        "counters": {
            "domain_architectures": 5423,
            "entries": 18,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 3,
                "ssf": 3,
                "pfam": 2,
                "cdd": 1,
                "smart": 1,
                "profile": 1,
                "panther": 1,
                "interpro": 6
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 5423
        }
    }
}