HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A7H8QSR3",
"id": "A0A7H8QSR3_TALRU",
"source_organism": {
"taxId": "121627",
"scientificName": "Talaromyces rugulosus",
"fullName": "Talaromyces rugulosus"
},
"name": "Eukaryotic translation initiation factor 2 subunit alpha",
"description": [
"eIF-2 functions in the early steps of protein synthesis by forming a ternary complex with GTP and initiator tRNA. This complex binds to a 40S ribosomal subunit, followed by mRNA binding to form a 43S pre-initiation complex. Junction of the 60S ribosomal subunit to form the 80S initiation complex is preceded by hydrolysis of the GTP bound to eIF-2 and release of an eIF-2-GDP binary complex. In order for eIF-2 to recycle and catalyze another round of initiation, the GDP bound to eIF-2 must exchange with GTP by way of a reaction catalyzed by eIF2B"
],
"length": 308,
"sequence": "MSLTNCRFYEEKYPEVDSFVMVNVKQIAEMGAYVKLLEYDNIDGMILLSELSRRRIRSIQKLIRIGRNEVVVVLRVDKEKGYIDLSKRRVSSEDVGKCEERYNKSKLVHSIMRHVAEKTKTPIEELYQNIGWPLNRNYGHSYDAFKLSITNPDVWNDVTFPNQLVKDELHTYIGKKLTPHPTKVRADVEVTCFGYDGIDAVKDALRAAEENNTPETQIKVKLVSPPLYVLTCQTLDKALGVKLLEEAIQNIEVKIKASNGTLTVKMAPKAVTAQDDVKLQELMDKRERENMEVSGDESQSESDEGVPE",
"proteome": "UP000509510",
"gene": "TRUGW13939_04090",
"go_terms": [
{
"identifier": "GO:0003676",
"name": "nucleic acid binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0003723",
"name": "RNA binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0003743",
"name": "translation initiation factor activity",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "2fb0ece446404da3daad65fe781defa909f63834",
"counters": {
"domain_architectures": 5423,
"entries": 18,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 3,
"ssf": 3,
"pfam": 2,
"cdd": 1,
"smart": 1,
"profile": 1,
"panther": 1,
"interpro": 6
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 5423
}
}
}