GET /api/protein/UniProt/A0A7H1B999/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A7H1B999",
        "id": "A0A7H1B999_9ACTN",
        "source_organism": {
            "taxId": "2768069",
            "scientificName": "Streptomyces xanthii",
            "fullName": "Streptomyces xanthii"
        },
        "name": "FMN dependent NADH:quinone oxidoreductase",
        "description": [
            "Also exhibits azoreductase activity. Catalyzes the reductive cleavage of the azo bond in aromatic azo compounds to the corresponding amines",
            "Quinone reductase that provides resistance to thiol-specific stress caused by electrophilic quinones"
        ],
        "length": 217,
        "sequence": "MATLLHIDSSLLPGAASSSRTVTDAFRNAWQEQHPEGTVVYRDLDTNPVPHLSAHAHLAGFSDPSAHTPEQAAAFAERVKLIEELERADAILIGAPMYNYSIPSTLKAWLDNVILFGRTAGVEAPAAKGTPVTVVASRGGSYAPGTPREGMEYVQNYLEAVLRDTLALDLDFIVPELTMAPQNPAMAELVPLFEASREKALLDAQRKGKETAARHAA",
        "proteome": "UP000516428",
        "gene": "azoR",
        "go_terms": [
            {
                "identifier": "GO:0010181",
                "name": "FMN binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0016655",
                "name": "oxidoreductase activity, acting on NAD(P)H, quinone or similar compound as acceptor",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "effa34ee8b593b78910e0b60ae539ba4e533ff91",
        "counters": {
            "domain_architectures": 49058,
            "entries": 9,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "cathgene3d": 1,
                "pfam": 1,
                "panther": 1,
                "hamap": 1,
                "interpro": 4
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 49058
        }
    }
}