HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A7H0TP81",
"id": "A0A7H0TP81_9ASTR",
"source_organism": {
"taxId": "2770830",
"scientificName": "Aldama goyazii",
"fullName": "Aldama goyazii"
},
"name": "Photosystem II CP47 reaction center protein",
"description": [
"One of the components of the core complex of photosystem II (PSII). It binds chlorophyll and helps catalyze the primary light-induced photochemical processes of PSII. PSII is a light-driven water:plastoquinone oxidoreductase, using light energy to abstract electrons from H(2)O, generating O(2) and a proton gradient subsequently used for ATP formation"
],
"length": 508,
"sequence": "MGLPWYRVHTVVLNDPGRLLSVHIMHTALVAGWAGSMALYELAVFDPSDPVLDPMWRQGMFVIPFMTRLGITNSWGGWSITGGTITNPGIWSYEGVAGAHIVFSGLCFLAAIWHWVYWDLEIFCDERTGKPSLDLPKIFGIHLFLAGLACFGFGAFHVTGLYGPGIWVSDPYGLTGKVQSVNPSWGVEGFDPFVPGGIASHHIAAGTLGILAGLFHLSVRPPQRLYKGLRMGNIETVLSSSIAAVFFAAFVVAGTMWYGSATTPIELFGPTRYQWDQGYFQQEIYRRVSAGLAENQSLSEVWSKIPEKLAFYDYIGNNPAKGGLFRAGSMDNGDGIAVGWLGHPIFRDKEGRELFVRRMPTFFETFPVVLVDGDGIVRADVPFRRAESKYSVEQVGVTVEFYGGELNGVSYSDPVTVKKYARRAQLGEIFELDRATLKSDGVFRSSPRGWFTFGHASFALLFFFGHIWHGSRTLFRDVFAGIDPDLDAQVEFGAFQKLGDPTTRRQAI",
"proteome": null,
"gene": "psbB",
"go_terms": [
{
"identifier": "GO:0016168",
"name": "chlorophyll binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0009767",
"name": "photosynthetic electron transport chain",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0019684",
"name": "photosynthesis, light reaction",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0009521",
"name": "photosystem",
"category": {
"code": "C",
"name": "cellular_component"
}
},
{
"identifier": "GO:0016020",
"name": "membrane",
"category": {
"code": "C",
"name": "cellular_component"
}
},
{
"identifier": "GO:0009772",
"name": "photosynthetic electron transport in photosystem II",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0015979",
"name": "photosynthesis",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0009523",
"name": "photosystem II",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "43a591bf7fa854337c3b9f2658c6bfb018907c99",
"counters": {
"domain_architectures": 34914,
"entries": 9,
"isoforms": 0,
"proteomes": 0,
"sets": 0,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 1,
"cathgene3d": 1,
"pfam": 1,
"ncbifam": 1,
"hamap": 1,
"panther": 1,
"interpro": 3
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 34914
}
}
}