General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A7H0LFH6",
        "id": "A0A7H0LFH6_9SPHN",
        "source_organism": {
            "taxId": "653931",
            "scientificName": "Sphingomonas alpina",
            "fullName": "Sphingomonas alpina"
        },
        "name": "Aldehyde oxidoreductase iron-sulfur-binding subunit PaoA",
        "description": [
            "Oxidizes aldehydes to the corresponding carboxylic acids with a preference for aromatic aldehydes. It might play a role in the detoxification of aldehydes to avoid cell damage"
        ],
        "length": 214,
        "sequence": "MSDPQALAMTRRGILTTGVAGVAVASTPAAALTETAPSPAAPPPTMKVTLKVNGKAGALDLDTRTTLLDALREHWKLTGTKKGCDHGQCGACTVIVEGRRINSCLTLAVMHDGDEITTIEGLGSPGDLHPMQAAFVQHDGFQCGYCTPGQICSAVSVLKEIRDGIPSHVSGDIVAAPQMTAHEMRERMSGNICRCGAYSNIIEAMLDVAKGVKA",
        "proteome": "UP000516148",
        "gene": "paoA",
        "go_terms": [
            {
                "identifier": "GO:0051536",
                "name": "iron-sulfur cluster binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0016491",
                "name": "oxidoreductase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0046872",
                "name": "metal ion binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0051537",
                "name": "2 iron, 2 sulfur cluster binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 4,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "eeee4871250ddb15b10e78e27dcb3364932ef337",
        "counters": {
            "domain_architectures": 39705,
            "entries": 22,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "profile": 2,
                "cathgene3d": 2,
                "ssf": 2,
                "cdd": 1,
                "pfam": 2,
                "ncbifam": 1,
                "panther": 1,
                "prosite": 2,
                "interpro": 9
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 39705
        }
    }
}